ATPB Antibody (1H2W2)

Novus Biologicals | Catalog # NBP3-15354

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1H2W2 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 230-529 of human ATPB (NP_001677.2). YSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHSS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATPB Antibody (1H2W2)

Immunohistochemistry-Paraffin: ATPB Antibody (1H2W2) [NBP3-15354]

Immunohistochemistry-Paraffin: ATPB Antibody (1H2W2) [NBP3-15354]

Immunohistochemistry-Paraffin: ATPB Antibody (9A1O2) [NBP3-15354] - Immunohistochemistry of paraffin-embedded human esophageal cancer using ATPB Rabbit mAb (NBP3-15354) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: ATPB Antibody (1H2W2) [NBP3-15354]

Immunohistochemistry-Paraffin: ATPB Antibody (1H2W2) [NBP3-15354]

Immunohistochemistry-Paraffin: ATPB Antibody (9A1O2) [NBP3-15354] - Immunohistochemistry of paraffin-embedded rat kidney using ATPB Rabbit mAb (NBP3-15354) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ATPB Antibody (9A1O2)

Western Blot: ATPB Antibody (9A1O2) [NBP3-15354] -

Western Blot: ATPB Antibody (9A1O2) [NBP3-15354] - analysis of extracts of various cell lines, using ATPB antibody at 1:20000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.
ATPB Antibody (9A1O2)

Immunocytochemistry/Immunofluorescence: ATPB Antibody (9A1O2) [NBP3-15354] -

Immunocytochemistry/Immunofluorescence: ATPB Antibody (9A1O2) [NBP3-15354] - HepG2 cells using ATPB Rabbit mAb (dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x.
ATPB Antibody (1H2W2)

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] -

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] - Immunohistochemistry analysis of ATPB in paraffin-embedded human colon carcinoma tissue using ATPB Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ATPB Antibody (1H2W2)

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] -

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] - Immunohistochemistry analysis of ATPB in paraffin-embedded Human lung adenocarcinoma tissue using ATPB Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ATPB Antibody (1H2W2)

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] -

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] - Immunohistochemistry analysis of ATPB in paraffin-embedded mouse kidney tissue using ATPB Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ATPB Antibody (1H2W2)

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] -

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] - Immunohistochemistry analysis of ATPB in paraffin-embedded human thyroid cancer tissue using ATPB Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ATPB Antibody (1H2W2)

Immunocytochemistry/ Immunofluorescence: ATPB Antibody (1H2W2) [ATPB] -

Immunocytochemistry/ Immunofluorescence: ATPB Antibody (1H2W2) [ATPB] - Confocal imaging of NIH/3T3 cells using ATPB Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ATPB Antibody (1H2W2)

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] -

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] - Immunohistochemistry analysis of ATPB in paraffin-embedded rat kidney tissue using ATPB Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ATPB Antibody (1H2W2)

Immunocytochemistry/ Immunofluorescence: ATPB Antibody (1H2W2) [ATPB] -

Immunocytochemistry/ Immunofluorescence: ATPB Antibody (1H2W2) [ATPB] - Confocal imaging of Hep G2 cells using ATPB Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ATPB Antibody (1H2W2)

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] -

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] - Immunohistochemistry analysis of ATPB in paraffin-embedded human liver cancer tissue using ATPB Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ATPB Antibody (1H2W2)

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] -

Immunohistochemistry: ATPB Antibody (1H2W2) [ATPB] - Immunohistochemistry analysis of ATPB in paraffin-embedded human liver tissue using ATPB Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for ATPB Antibody (1H2W2)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:3000 - 1:20000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ATPB

ATP synthase is extremely conserved through evolution and can be found in plants, fungi, bacteria, and animals. The ATP synthase enzyme is a transmembrane protein responsible for driving the reversible reaction from ADP+ phosphate to ATP. This reaction is accomplished by a flux of protons across the membrane as a result of electron transfer. The ATP synthase protein has two main sections; the F1 ATP-ase (soluble) and the F0 ATP-ase (membrane embedded). The F1 section consists of the alpha, beta, gamma, delta, and epsilon subunits. While the F0 consists of a, b, and c subunits.

Alternate Names

ATP synthase subunit beta, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide, ATPMB, ATPSBmitochondrial ATP synthase beta subunit, EC 3.6.3, EC 3.6.3.14, MGC5231, mitochondrial ATP synthetase, beta subunit

Gene Symbol

ATP5F1B

Additional ATPB Products

Product Documents for ATPB Antibody (1H2W2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATPB Antibody (1H2W2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATPB Antibody (1H2W2)

There are currently no reviews for this product. Be the first to review ATPB Antibody (1H2W2) and earn rewards!

Have you used ATPB Antibody (1H2W2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...