AXUD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56676

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AXUD1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: AXUD1 Antibody [NBP2-56676]

Immunocytochemistry/ Immunofluorescence: AXUD1 Antibody [NBP2-56676]

Immunocytochemistry/Immunofluorescence: AXUD1 Antibody [NBP2-56676] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
AXUD1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: AXUD1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: AXUD1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-AXUD1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for AXUD1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AXUD1

Axin, an important regulator of beta-catenin, is frequently mutated in human hepatocellular carcinomas (HCCs), and transduction of the wild-type Axin gene (AXIN1) induces apoptosis in HCC cells as well as in colon cancer cells. A novel gene, AXUD1 (AXIN 1 up-regulated), has enhanced expression in response to exogenously expressed AXIN1. It is expressed in all human tissues examined, most abundantly in lung, placenta, skeletal muscle, pancreas and leukocytes. Data suggests that AXUD1 may have a tumor-suprressor function in those organs.

Alternate Names

AXIN1 up-regulated 1, Axin-1 up-regulated gene 1 protein, AXUD1DKFZp566F164, CSRNP-1, cysteine/serine-rich nuclear protein 1, cysteine-serine-rich nuclear protein 1, FAM130B, Protein URAX1, TAIP3, TAIP-3TGF-beta-induced apoptosis protein 3, TGF-beta induced apoptosis protein 3, URAX1

Gene Symbol

CSRNP1

Additional AXUD1 Products

Product Documents for AXUD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for AXUD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AXUD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AXUD1 Antibody - BSA Free and earn rewards!

Have you used AXUD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...