BAF57 Antibody (9L5F6)

Novus Biologicals | Catalog # NBP3-16279

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9L5F6 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57 (NP_003070.3). SKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKII

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BAF57 Antibody (9L5F6)

Western Blot: BAF57 Antibody (9L5F6) [NBP3-16279]

Western Blot: BAF57 Antibody (9L5F6) [NBP3-16279]

Western Blot: BAF57 Antibody (9L5F6) [NBP3-16279] - Western blot analysis of extracts of various cell lines, using BAF57 Rabbit mAb (NBP3-16279) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: BAF57 Antibody (9L5F6) [NBP3-16279]

Immunocytochemistry/ Immunofluorescence: BAF57 Antibody (9L5F6) [NBP3-16279]

Immunocytochemistry/Immunofluorescence: BAF57 Antibody (9L5F6) [NBP3-16279] - Immunofluorescence analysis of U-2 OS cells using BAF57 Rabbit mAb (NBP3-16279) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Western Blot: BAF57 Antibody (9L5F6) [NBP3-16279]

Western Blot: BAF57 Antibody (9L5F6) [NBP3-16279]

Western Blot: BAF57 Antibody (9L5F6) [NBP3-16279] - Western blot analysis of extracts of various cell lines, using BAF57 Rabbit mAb (NBP3-16279) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunocytochemistry/ Immunofluorescence: BAF57 Antibody (9L5F6) [NBP3-16279]

Immunocytochemistry/ Immunofluorescence: BAF57 Antibody (9L5F6) [NBP3-16279]

Immunocytochemistry/Immunofluorescence: BAF57 Antibody (9L5F6) [NBP3-16279] - Immunofluorescence analysis of NIH-3T3 cells using BAF57 Rabbit mAb (NBP3-16279) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Applications for BAF57 Antibody (9L5F6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BAF57

BAF57 is encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart.

Alternate Names

BAF57BRG1-associated factor 57, chromatin remodeling complex BRG1-associated factor 57, subfamily e, member 1, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin e1, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily E member 1

Gene Symbol

SMARCE1

Additional BAF57 Products

Product Documents for BAF57 Antibody (9L5F6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BAF57 Antibody (9L5F6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BAF57 Antibody (9L5F6)

There are currently no reviews for this product. Be the first to review BAF57 Antibody (9L5F6) and earn rewards!

Have you used BAF57 Antibody (9L5F6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...