BAF57 Antibody (9L5F6)
Novus Biologicals | Catalog # NBP3-16279
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 9L5F6 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 2-100 of human BAF57 (NP_003070.3). SKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKII
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for BAF57 Antibody (9L5F6)
Western Blot: BAF57 Antibody (9L5F6) [NBP3-16279]
Western Blot: BAF57 Antibody (9L5F6) [NBP3-16279] - Western blot analysis of extracts of various cell lines, using BAF57 Rabbit mAb (NBP3-16279) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.Immunocytochemistry/ Immunofluorescence: BAF57 Antibody (9L5F6) [NBP3-16279]
Immunocytochemistry/Immunofluorescence: BAF57 Antibody (9L5F6) [NBP3-16279] - Immunofluorescence analysis of U-2 OS cells using BAF57 Rabbit mAb (NBP3-16279) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Western Blot: BAF57 Antibody (9L5F6) [NBP3-16279]
Western Blot: BAF57 Antibody (9L5F6) [NBP3-16279] - Western blot analysis of extracts of various cell lines, using BAF57 Rabbit mAb (NBP3-16279) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.Immunocytochemistry/ Immunofluorescence: BAF57 Antibody (9L5F6) [NBP3-16279]
Immunocytochemistry/Immunofluorescence: BAF57 Antibody (9L5F6) [NBP3-16279] - Immunofluorescence analysis of NIH-3T3 cells using BAF57 Rabbit mAb (NBP3-16279) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Applications for BAF57 Antibody (9L5F6)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: BAF57
Alternate Names
BAF57BRG1-associated factor 57, chromatin remodeling complex BRG1-associated factor 57, subfamily e, member 1, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin e1, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily E member 1
Gene Symbol
SMARCE1
Additional BAF57 Products
Product Documents for BAF57 Antibody (9L5F6)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BAF57 Antibody (9L5F6)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for BAF57 Antibody (9L5F6)
There are currently no reviews for this product. Be the first to review BAF57 Antibody (9L5F6) and earn rewards!
Have you used BAF57 Antibody (9L5F6)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...