BANF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38442

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BANF1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: BANF1 Antibody [NBP2-38442]

Immunocytochemistry/ Immunofluorescence: BANF1 Antibody [NBP2-38442]

Immunocytochemistry/Immunofluorescence: BANF1 Antibody [NBP2-38442] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.
BANF1 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: BANF1 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: BANF1 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-BANF1 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.
BANF1 Antibody - BSA Free Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442]

Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442]

Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.
BANF1 Antibody - BSA Free Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442]

Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442]

Analysis in human fallopian tube and liver tissues. Corresponding RNA-seq data are presented for the same tissues.
BANF1 Antibody - BSA Free Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442]

Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442]

Staining of human liver shows low positivity in hepatocytes as expected.
BANF1 Antibody - BSA Free Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442]

Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442]

Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
BANF1 Antibody - BSA Free Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442]

Immunohistochemistry-Paraffin: BANF1 Antibody [NBP2-38442]

Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

Applications for BANF1 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 2 using NBP2-38442 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BANF1

BANF1 is encoded by this gene was identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The endogenous function of the protein is unknown. The protein forms a homodimer which localizes to the nucleus and is specifically associated with chromosomes during mitosis. This protein binds to DNA in a non-specific manner and studies in rodents suggest that it also binds to lamina-associated polypeptide 2, a component of the nuclear lamina.

Long Name

Barrier-to-autointegration factor

Alternate Names

BCRG1

Gene Symbol

BANF1

UniProt

Additional BANF1 Products

Product Documents for BANF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BANF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BANF1 Antibody - BSA Free (1)

2 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
0%
3 Stars
0%
2 Stars
100%
1 Stars
0%

Have you used BANF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 1 of 1 review Showing All
Filter By:
  • BANF1 Antibody
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: MEF and Mouse embryonic fibroblasts
    Species: Mouse
    Verified Customer | Posted 01/31/2021
    Immunocytochemistry/Immunofluorescence: BANF1 Antibody [NBP2-38442] - Staining of mouse embryonic fibroblasts shows slightly localization to nucleoplasm.
    ICC of MEFs incubated overnight at 4C with1:25 diluted Ab (2 ug/ml) after fixation with 4% PFA for 15 min and permeabilization with 1% TritonX-100 for 10 min.
    BANF1 Antibody - BSA Free NBP2-38442
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...