Brorin (brain-specific chordin-like protein), also called VWC2, is an ~46 kDa glycoprotein that is a member of the Chordin family of secreted BMP regulators. The human Brorin cDNA encodes 325 amino acids (aa) including a 27 aa signal sequence and a 298 aa secreted mature protein with two VWFC domains. These domains contain a pattern of 10 cysteine residues that is conserved in other family members, with the remaining aa sequence sharing little identity. Human Brorin shares 90%, 91%, and 95% aa sequence identity with mouse, rat, and equine Brorin, respectively. It also shares aa identity with VWC2L (Brorin-like) of 37% overall and 62% within the VWFC domains. Brorin is predominantly expressed in embryonic and adult neural tissues in the mouse. Expression of Brorin mRNA is concentrated in neurons within the diencephalon and medulla oblongata but is not detected in the developing cerebral cortex. Brorin binds and antagonizes BMPs, interacting via the VWFC domains. It promotes neurogenesis in mouse neural precursors. Knockdown of Brorin in zebrafish embryos results in morphological abnormalities in the brain and eye.
Brorin/VWC2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-33745
Loading...
Key Product Details
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYR
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Brorin/VWC2 Antibody - BSA Free
Western Blot: Brorin/VWC2 Antibody [NBP2-33745]
Western Blot: Brorin/VWC2 Antibody [NBP2-33745] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745]
Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745] - Staining of breast cancer.Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745]
Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745] - Staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745]
Immunohistochemistry-Paraffin: Brorin/VWC2 Antibody [NBP2-33745] - Staining of liver.Applications for Brorin/VWC2 Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Brorin/VWC2
Long Name
von Willebrand Factor A2 Domain
Alternate Names
Brain-specific chordin-like protein, VWC2
Gene Symbol
VWC2
UniProt
Additional Brorin/VWC2 Products
Product Documents for Brorin/VWC2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Brorin/VWC2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Brorin/VWC2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Brorin/VWC2 Antibody - BSA Free and earn rewards!
Have you used Brorin/VWC2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...