BRP44L Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91706

Novus Biologicals
Loading...

Key Product Details

Validated by

Knockout/Knockdown, Orthogonal Validation

Species Reactivity

Validated:

Human

Cited:

Human, Mouse

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Validated:

Knockout Validated, Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BRP44L Antibody - BSA Free

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining in human heart muscle and pancreas tissues.. Corresponding MPC1 RNA-seq data are presented for the same tissues.
Western Blot: BRP44L Antibody [NBP1-91706]

Western Blot: BRP44L Antibody [NBP1-91706]

Western Blot: BRP44L Antibody [NBP1-91706] - Analysis in human cell lines HEK293 and A-549 using anti-MPC1 antibody. Corresponding MPC1 RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.
Immunocytochemistry/ Immunofluorescence: BRP44L Antibody [NBP1-91706]

Immunocytochemistry/ Immunofluorescence: BRP44L Antibody [NBP1-91706]

Immunocytochemistry/Immunofluorescence: BRP44L Antibody [NBP1-91706] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human kidney shows moderate to strong positivity in mitochondria in cells in tubules.
Western Blot: BRP44L Antibody [NBP1-91706]

Western Blot: BRP44L Antibody [NBP1-91706]

Western Blot: BRP44L Antibody [NBP1-91706] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human duodenum shows strong positivity in mitochondria in glandular cells.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human heart muscle shows strong positivity in mitochondria in cardiomyocytes.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human pancreas shows weak positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706]

Immunohistochemistry-Paraffin: BRP44L Antibody [NBP1-91706] - Staining of human salivary gland shows strong positivity in mitochondria in ductal cells.
BRP44L Antibody

Western Blot: BRP44L Antibody [NBP1-91706] -

Western Blot: BRP44L Antibody [NBP1-91706] - Characterization of MPC1−/− in the RM-1 murine prostate cancer cells(A) Shows representative sequencings of the MPC1 PCR products in WT & MPC1−/− cells. The upper panel shows a representative MPC1 PCR product sequencing chart of WT cells at the left part, & the right part on the upper panel shows the full cDNA sequence & the speculated amino acids (110 amino acids). The left part on the lower panel shows a representative MPC1 PCR product of the MPC1−/− cells, which reveals double sets of peak. The right part of the lower panel shows the mutated DNA sequences at both alleles, on which one allele on the upper part has a two-base “at” deletion (green arrow), while another allele on the lower part harbors one base “a” insertion (red arrow). Both mutated sequences create an early terminator “tga”, which results in only 1/3 of the translation (41 amino acids in the upper allele & 42 amino cods in another allele). (B) The IF & IHC results. Co-localization of MPC1 or MPC2 & the mitochondrial protein MT-CO1 are shown in the WT RM-1 cells, while there is no MPC1 protein expression revealed by either IF or ICC in the MPC1−/− cells. There was only weak MPC2 protein expression in the MPC1−/− cells revealed by ICC. Scale bars, 200 μm. Western blotting results of subcellular proteins from WT & MPC1−/− cells & corresponding densitometry histograms of ALT1 & PC are shown in (C). Cyto means cytoplasmic protein. Mito stands for mitochondrial protein. Protein alpha -Tublin was used as a loading control. ***P<0.001. All experiments were performed at least three times with consistent & repeatable results. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/28624784), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BRP44L Antibody

Western Blot: BRP44L Antibody [NBP1-91706] -

Western Blot: BRP44L Antibody [NBP1-91706] - The results of western blotting & RT-PCR assayA. shows Western blotting results, where the PDHA1 protein expression in the parental LNCaP cells is strongly positive, but its expression in the PDHA1 KO cells is almost negative with two different PDHA1 antibodies. Comparatively, the protein expression of the MPC1 & MPC2 is comparatively decreased & the protein expression of the GLUT1, HK2, LDHA, HIF1 alpha, GLS1 & GLUD1 is increased in the LNCaP PDHA1 KO cells. GAPDH was added as a loading control. B. shows the RT-PCR results of the mRNA expression of GLUD1 & GLS1, where the expression of the GLUD1 & GLS1 is significantly increased in the PDHA1 KO cells, with P values of 0.000 & 0.001, respectively, compared to the parental LNCaP cells. **P < 0.01, ***P<0.001. Image collected & cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/27462778), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
BRP44L Antibody - BSA Free Western Blot: BRP44L Antibody - BSA Free [NBP1-91706]

Western Blot: BRP44L Antibody - BSA Free [NBP1-91706]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue

Applications for BRP44L Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BRP44L

Long Name

Mitochondrial pyruvate carrier 1

Alternate Names

CGI-129, HSPC040, MPC1, PNAS-115

Gene Symbol

MPC1

Additional BRP44L Products

Product Documents for BRP44L Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BRP44L Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for BRP44L Antibody - BSA Free

Customer Reviews for BRP44L Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRP44L Antibody - BSA Free and earn rewards!

Have you used BRP44L Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...