BSND Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-49101
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SPQQEPQGCRCPLDRFQDFALIDAPTLEDEPQEGQQWEIALPNNWQRYPRTKVEEKEASDTGGEEPEKEEEDLYYGLPDGAGDL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for BSND Antibody - BSA Free
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human salivary gland shows moderate to strong cytoplasmic positivity in glandular cells.Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Barttin is expressed by dark cells surrounding the ampulla and utricle in the adult mouse vestibular system. Antibody at 1:1000. Nuclei stained with DAPI. IHC-P image submitted by a verified customer review.Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human kidney, liver, salivary gland and skeletal muscle using Anti-BSND antibody NBP2-49101 (A) shows similar protein distribution across tissues to independent antibody NBP2-62634 (B).Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101]
Immunohistochemistry-Paraffin: BSND Antibody [NBP2-49101] - Staining of human liver shows no positivity in hepatocytes as expected.Applications for BSND Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:2500 - 1:5000
Immunohistochemistry-Paraffin
1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Reviewed Applications
Read 1 review rated 5 using NBP2-49101 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: BSND
Alternate Names
BARTMGC119284, Bartter syndrome, infantile, with sensorineural deafness (Barttin), barttin, deafness, autosomal recessive 73, DFNB73, MGC119283, MGC119285
Gene Symbol
BSND
Additional BSND Products
Product Documents for BSND Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for BSND Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for BSND Antibody - BSA Free
Customer Reviews for BSND Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used BSND Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Customer Images
Showing
1
-
1 of
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-ParaffinSample Tested: Mouse inner earSpecies: MouseVerified Customer | Posted 06/30/2020Barttin (NBP2-49101, 1:1000) is expressed by dark cells surrounding the ampulla and utricle in the adult mouse vestibular system. Nuclei stained with DAPI.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...