c-Myc-responsive protein Rcl Antibody (7C1Z8)
Novus Biologicals | Catalog # NBP3-16115
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 7C1Z8 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 75-174 of human c-Myc-responsive protein Rcl (O43598). LIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFRPQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for c-Myc-responsive protein Rcl Antibody (7C1Z8)
Western Blot: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115]
Western Blot: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] - Western blot analysis of extracts of various cell lines, using c-Myc-responsive protein Rcl antibody (NBP3-16115) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.Immunocytochemistry/ Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] -
Immunocytochemistry/ Immunofluorescence: c-Myc-responsive protein Rcl Antibody (7C1Z8) [NBP3-16115] - Confocal imaging of MCF7 cells using c-Myc-responsive protein Rcl Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Applications for c-Myc-responsive protein Rcl Antibody (7C1Z8)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: c-Myc-responsive protein Rcl
Alternate Names
chromosome 6 open reading frame 108, c-Myc-responsive protein Rcl, deoxyribonucleoside 5'-monophosphate N-glycosidase, dJ330M21.3, EC 3.2.2, EC 3.2.2.-, putative c-Myc-responsive, RCL, RP3-330M21.3
Gene Symbol
DNPH1
Additional c-Myc-responsive protein Rcl Products
Product Documents for c-Myc-responsive protein Rcl Antibody (7C1Z8)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for c-Myc-responsive protein Rcl Antibody (7C1Z8)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for c-Myc-responsive protein Rcl Antibody (7C1Z8)
There are currently no reviews for this product. Be the first to review c-Myc-responsive protein Rcl Antibody (7C1Z8) and earn rewards!
Have you used c-Myc-responsive protein Rcl Antibody (7C1Z8)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...