C1qTNF proteins constitute a highly conserved family of Acrp30/Adiponectin paralogs that share a modular organization comprising an N-terminal signal peptide, a short variable region, a collagenous domain and a C-terminal globular domain. C1qTNF proteins are predicted to have trimeric structures that assemble into hexameric and higher order molecular forms. C1qTNF3, also known as CORS26, is predominantly expressed in cartilage and is induced in mature adipocytes. C1qTNF10, also known as C1qL2, is a protein that shows 28% - 30% sequence identity with C1q subunits A, B, and C. It is predicted to contain one collagen-like and C1q domain. Mouse and human C1qTNF10 share over 90% amino acid sequence identity.
C1qTNF10/C1qL2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-84549
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human C1qTNF10/C1qL2. Peptide sequence: GTASGVGVVGGGAGVGGDSEGEVTSALSATFSGPKIAFYVGLKSPHEGYE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Scientific Data Images for C1qTNF10/C1qL2 Antibody - BSA Free
Western Blot: C1qTNF10/C1qL2 Antibody [NBP2-84549]
Western Blot: C1qTNF10/C1qL2 Antibody [NBP2-84549] - Host: Rabbit. Target Name: C1QL2. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/mlApplications for C1qTNF10/C1qL2 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: C1qTNF10/C1qL2
Long Name
C1q And Tumor Necrosis Factor Related Protein 10
Alternate Names
C1qL2
Gene Symbol
C1QL2
Additional C1qTNF10/C1qL2 Products
Product Documents for C1qTNF10/C1qL2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for C1qTNF10/C1qL2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for C1qTNF10/C1qL2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review C1qTNF10/C1qL2 Antibody - BSA Free and earn rewards!
Have you used C1qTNF10/C1qL2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...