Cadherin-23 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87114

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human Cadherin-23. Peptide sequence: DHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATD The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Cadherin-23 Antibody - BSA Free

Western Blot: Cadherin-23 Antibody [NBP2-87114]

Western Blot: Cadherin-23 Antibody [NBP2-87114]

Western Blot: Cadherin-23 Antibody [NBP2-87114] - Host: Rabbit. Target Name: CDH23. Sample Type: Fetal Brain lysates. Antibody Dilution: 1.0ug/ml

Applications for Cadherin-23 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cadherin-23

CDH23 is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein is a large, single-pass transmembrane protein composed of an extracellular domain containing 27 repeats that show significant homology to the cadherin ectodomain. Expressed in the neurosensory epithelium, the protein is thought to be involved in stereocilia organization and hair bundle formation. The gene is located in a region containing the human deafness loci DFNB12 and USH1D. Usher syndrome 1D and nonsyndromic autosomal recessive deafness DFNB12 are caused by allelic mutations of this cadherin-like gene. Two alternative splice variants have been identified that encode different isoforms. Additional variants have been observed but their full-length nature has not been determined.

Alternate Names

cadherin related 23, cadherin-23, cadherin-like 23, cadherin-related 23, cadherin-related family member 23, CDHR23, DKFZp434P2350, FLJ00233, FLJ36499, KIAA1774, KIAA1812, MGC102761, Otocadherin, USH1D

Gene Symbol

CDH23

Additional Cadherin-23 Products

Product Documents for Cadherin-23 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cadherin-23 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cadherin-23 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cadherin-23 Antibody - BSA Free and earn rewards!

Have you used Cadherin-23 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...