Calcium-sensing R/CaSR Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-84687
Loading...
Key Product Details
Validated by
Orthogonal Validation, Independent Antibodies
Species Reactivity
Human
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGETDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGG
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Calcium-sensing R/CaSR Antibody - BSA Free
Western Blot: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Western Blot: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Analysis in control (vector only transfected HEK293T lysate) and CASR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human liver shows no positivity in hepatocytes as expected.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human kidney shows strong cytoplasmic positivity in subset of cells in tubules.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human parathyroid gland shows high expression.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human skeletal muscle shows low expression as expected.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human kidney.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human liver.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human parathyroid gland using Anti-CASR antibody NBP1-84687.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human skeletal muscle using Anti-CASR antibody NBP1-84687.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human kidney, liver, pancreas and parathyroid gland using Anti-CASR antibody NBP1-84687 (A) shows similar protein distribution across tissues to independent antibody NBP2-38622 (B).Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Analysis in human parathyroid gland and skeletal muscle tissues using NBP1-84687 antibody. Corresponding CASR RNA-seq data are presented for the same tissues.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human parathyroid gland shows strong membranous positivity in glandular cells.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human kidney shows moderate membranous positivity in cells in distal tubules.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human pancreas shows moderate membranous positivity in islets of Langerhans.Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687]
Immunohistochemistry-Paraffin: Calcium-sensing R/CaSR Antibody [NBP1-84687] - Staining of human skeletal muscle shows no positivity in myocytes as expected.Applications for Calcium-sensing R/CaSR Antibody - BSA Free
Application
Recommended Usage
Immunohistochemistry
1:1000 - 1:2500
Immunohistochemistry-Paraffin
1:1000 - 1:2500
Western Blot
0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Calcium-sensing R/CaSR
Mutations that inactivate CaSR lead to familial hypocalciuric hypercalcemia, whereas mutations that activate CaSR cause autosomal dominant hypocalcemia. Calcium-Sensing Receptor antibodies are useful tools for parathyroid studies and research on cellular calcium homeostasis regulation.
Long Name
Calcium-sensing Receptor
Alternate Names
CAR, CaSR, EIG8, FHH, FIH, GPRC2A, HHC1, NSHPT, PCaR1
Gene Symbol
CASR
Additional Calcium-sensing R/CaSR Products
Product Documents for Calcium-sensing R/CaSR Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Calcium-sensing R/CaSR Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Calcium-sensing R/CaSR Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Calcium-sensing R/CaSR Antibody - BSA Free and earn rewards!
Have you used Calcium-sensing R/CaSR Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...