Calmodulin Antibody (10W3Y7)

Novus Biologicals | Catalog # NBP3-16500

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10W3Y7 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 70-149 of human Calmodulin (NP_008819.1). LTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

16 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Calmodulin Antibody (10W3Y7)

Western Blot: Calmodulin Antibody (10W3Y7) [NBP3-16500]

Western Blot: Calmodulin Antibody (10W3Y7) [NBP3-16500]

Western Blot: Calmodulin Antibody (10W3Y7) [NBP3-16500] - Western blot analysis of extracts of various cell lines, using Calmodulin Rabbit mAb (NBP3-16500) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Calmodulin Antibody (10W3Y7)

Immunocytochemistry/ Immunofluorescence: Calmodulin Antibody (10W3Y7) [NBP3-16500] -

Immunocytochemistry/ Immunofluorescence: Calmodulin Antibody (10W3Y7) [NBP3-16500] - Confocal imaging of paraffin-embedded Rat brain using Calmodulin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Calmodulin Antibody (10W3Y7)

Immunocytochemistry/ Immunofluorescence: Calmodulin Antibody (10W3Y7) [Calmodulin] -

Immunocytochemistry/ Immunofluorescence: Calmodulin Antibody (10W3Y7) [Calmodulin] - Confocal imaging of paraffin-embedded Mouse brain using Calmodulin Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Applications for Calmodulin Antibody (10W3Y7)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.

Immunocytochemistry/ Immunofluorescence

1:100 - 1:1000

Western Blot

1:1000 - 1:6000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Calmodulin 1

Calmoduin (CaM) is a calcium modulator protein and a transducer of calcium signals (1-2). Upon calcium binding, calmodulin undergoes conformational changes and binds and modulates a diverse array of proteins. Calcium-bound CaM (Ca2+-CaM) can assume a variety of shapes depending on the target (3). Ca2+-CaM binds many kinases, phosphatases, signaling proteins, and structural proteins affecting a wide variety of processes including neurotransmitter release, muscle contraction, metabolism, apoptosis, inflammation, membrane protein organization, and cytoskeleton movement (2, 4-5).

Alternate Names

CALM1, CALML2, CaM, CAM1, CAMI, CPVT4, DD132

Gene Symbol

CALM1

Additional Calmodulin 1 Products

Product Documents for Calmodulin Antibody (10W3Y7)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Calmodulin Antibody (10W3Y7)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calmodulin Antibody (10W3Y7)

There are currently no reviews for this product. Be the first to review Calmodulin Antibody (10W3Y7) and earn rewards!

Have you used Calmodulin Antibody (10W3Y7)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Calmodulin Antibody (10W3Y7)

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I am looking for an antibody that can bind an engineered calmodulin domain of a fluorescent biosensor. Can you provide me the amino acid sequence that your calmodulin antibodies were raised against so that I can compare them to the sequence I am working with? Can you please provide your sequence identity for this fragment: D Q L T E E Q I A E F K E A F S L F D K D G D G T I T T K E L G T V M R S L G Q N P T E A E L Q D M I N E V D A D G D G T I D F P E F L T M M A R K M W G T D S E E E I R E A F R V F D K D G N G Y I G A A E L R H V M A N L G E R L T D E E V D E M I R V A D I N G D G Q V S Y E E F V Q M M T A K

    A:

    Please see this link to our available calmodulin antibodies. This sequences shares 94% similarity with human calmodulin and does not share 100% similarity with any known calmodulin sequence. Any of our calmodulin antibodies will be predicted to react with this sequence. Any of our polyclonal antibodies will be a good choice and chances are most of the monoclonal antibodies will cross-react as well although, unfortunately, there is no way to predict this with the monoclonals. NBP1-61548 would be my best recommendation for your assay and sequence.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies