CAMLG Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-35381

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human CAMLG (NP_001736.1).

Sequence:
MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CAMLG Antibody - BSA Free

CAMLG Antibody

Immunocytochemistry/ Immunofluorescence: CAMLG Antibody [NBP3-35381] -

Immunocytochemistry/ Immunofluorescence: CAMLG Antibody [NBP3-35381] - Immunofluorescence analysis of NIH-3T3 cells using CAMLG Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
CAMLG Antibody

Immunohistochemistry: CAMLG Antibody [NBP3-35381] -

Immunohistochemistry: CAMLG Antibody [NBP3-35381] - Immunohistochemistry analysis of paraffin-embedded Mouse lung using CAMLG Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CAMLG Antibody

Western Blot: CAMLG Antibody [NBP3-35381] -

Western Blot: CAMLG Antibody [NBP3-35381] - Western blot analysis of various lysates using CAMLG Rabbit pAb at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
CAMLG Antibody

Immunohistochemistry: CAMLG Antibody [NBP3-35381] -

Immunohistochemistry: CAMLG Antibody [NBP3-35381] - Immunohistochemistry analysis of paraffin-embedded Human stomach using CAMLG Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.
CAMLG Antibody

Immunocytochemistry/ Immunofluorescence: CAMLG Antibody [NBP3-35381] -

Immunocytochemistry/ Immunofluorescence: CAMLG Antibody [NBP3-35381] - Immunofluorescence analysis of U-2 OS cells using CAMLG Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for CAMLG Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:100

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CAMLG

The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. The protein encoded by this gene functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin. [provided by RefSeq]

Alternate Names

calcium modulating ligand, calcium signal-modulating cyclophilin ligand, calcium-signal modulating cyclophilin ligand, CAMLcalcium-modulating cyclophilin ligand, cyclophilin B-binding protein, MGC163197

Gene Symbol

CAMLG

Additional CAMLG Products

Product Documents for CAMLG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CAMLG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CAMLG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CAMLG Antibody - BSA Free and earn rewards!

Have you used CAMLG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...