Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
Synthetic peptides corresponding to CCT8(chaperonin containing TCP1, subunit 8 (theta)) The peptide sequence was selected from the C terminal of CCT8.
Peptide sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK. The peptide sequence for this immunogen was taken from within the described region.
Specificity
This product is specific to Subunit or Isoform: theta.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Scientific Data Images for CCT8 Antibody - BSA Free
Western Blot: CCT8 Antibody [NBP1-56608]
Western Blot: CCT8 Antibody [NBP1-56608] - Antibody Titration: 0.2-1 ug/ml Positive control: Jurkat cell lysate. CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.Western Blot: CCT8 Antibody [NBP1-56608]
Western Blot: CCT8 Antibody [NBP1-56608] - Sample Type: HEK 293 (10ug) Primary Dilution: 1:1000 Secondary Antibody: conjugated goat anti-rabbit Secondary Dilution: 1:10,000 Image Submitted By: Amy Gray Brigham Young UniversityWestern Blot: CCT8 Antibody [NBP1-56608]
Western Blot: CCT8 Antibody [NBP1-56608] - C-terminal region validated by WB using HEK 293T at 1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies.Applications for CCT8 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CCT8
Alternate Names
C21orf112, Cctq, CCT-theta, chaperonin containing TCP1, subunit 8 (theta), chromosome 21 open reading frame 112, D21S246, KIAA0002, PRED71, T-complex protein 1 subunit theta, T-complex protein 1, theta subunit, 10Renal carcinoma antigen NY-REN-15, TCP-1-theta
Gene Symbol
CCT8
Additional CCT8 Products
Product Documents for CCT8 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CCT8 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CCT8 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CCT8 Antibody - BSA Free and earn rewards!
Have you used CCT8 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...