Recombinant Human CDK20 GST (N-Term) Protein

Novus Biologicals | Catalog # H00023552-P01

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection
Loading...

Product Specifications

Description

A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-275 of Human CCRK

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDQYCILGRIGEGAHGIVFKAKHVETGEIVALKKVALRRLEDGFPNQALREIKALQEMEDNQYVVQLKAVFPHGGGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVAFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRSVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQVWPELTELPDYNKISFKEQVPMPLEEVLPDVSPQALDLLGQFLLYPPHQRIAASKLPCLPIHLSCRFLSV

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

55.99 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human CDK20 GST (N-Term) Protein

SDS-PAGE: Recombinant Human CDK20 GST (N-Term) Protein [H00023552-P01]

SDS-PAGE: Recombinant Human CDK20 GST (N-Term) Protein [H00023552-P01]

SDS-Page: Recombinant Human CDK20 Protein [H00023552-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00023552-P01
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: CDK20

CCRK( AAH02655, 1 a.a. - 276 a.a.) recombinant protein with GST.

Long Name

Cyclin-dependent kinase 20

Alternate Names

CAK-kinase p42, CCRK, CDCH

Gene Symbol

CDK20

Additional CDK20 Products

Product Documents for Recombinant Human CDK20 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human CDK20 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Citations for Recombinant Human CDK20 GST (N-Term) Protein

Customer Reviews for Recombinant Human CDK20 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human CDK20 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human CDK20 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs for Recombinant Human CDK20 GST (N-Term) Protein

Showing  1 - 2 of 2 FAQs Showing All
  • Q: Could you please let me know what was the expression system (E coli, insect cells,...?) of the CDK20 recombinant protein (H00023552-P01)?

    A:

    This protein was expressed in a cell-free wheat germ synthesis system. It has not been tested for any biological activity, and is mainly intended for use as a positive control with the corresponding antibodies. We actually distribute this item for a Taiwanese company called Abnova. Find more info about their wheat germ expression system (http://www.abnova.com/support/Protein.asp).

  • Q: What is the buffer composition of the product? I need the same buffer as a control for my experiment.

    A: This protein is provided in 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0.

  • Q: Could you please let me know what was the expression system (E coli, insect cells,...?) of the CDK20 recombinant protein (H00023552-P01)?

    A:

    This protein was expressed in a cell-free wheat germ synthesis system. It has not been tested for any biological activity, and is mainly intended for use as a positive control with the corresponding antibodies. We actually distribute this item for a Taiwanese company called Abnova. Find more info about their wheat germ expression system (http://www.abnova.com/support/Protein.asp).

  • Q: What is the buffer composition of the product? I need the same buffer as a control for my experiment.

    A: This protein is provided in 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0.

Showing  1 - 2 of 2 FAQs Showing All
View all FAQs for Proteins and Enzymes
Loading...