CEACAMs are intercellular adhesion molecules that form Ca2+-dependent homo- and heterotypic interactions, and typically serve as pathogen receptors. All CEACAMs are heavily glycosylated and contain one N-terminal V-type Ig-like domain. CEACAMs also exhibit variability in their structure by containing transmembrane domains (#CEACAM-1, 3 & 4), GPI-linked domains (#5, 6, 7, & 8), or CD66 designations (#1, 3, 5, 6, & 7).
CEACAM4 Antibody - BSA Free
Novus Biologicals | Catalog # NBP3-10587
![Western Blot: CEACAM4 Antibody [NBP3-10587]](https://resources.rndsystems.com/images/products/CEACAM4-Antibody-Western-Blot-NBP3-10587-img0001.jpg "Western Blot: CEACAM4 Antibody [NBP3-10587]")
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Loading...
Key Product Details
Species Reactivity
Human
Applications
Western Blot
Label
Unconjugated
Antibody Source
Polyclonal Rabbit
Format
BSA Free
Loading...
Product Specifications
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CEACAM4 (NP_001808). Peptide sequence FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITD
Clonality
Polyclonal
Host
Rabbit
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for CEACAM4 Antibody - BSA Free
Western Blot: CEACAM4 Antibody [NBP3-10587]
Western Blot: CEACAM4 Antibody [NBP3-10587] - Western blot analysis using NBP3-10587 on Human Lung as a positive control. Antibody Titration: 0.2-1 ug/mlApplications for CEACAM4 Antibody - BSA Free
Application
Recommended Usage
Western Blot
1.0 ug/ml
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS, 2% Sucrose
Format
BSA Free
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CEACAM-4
Long Name
Carcinoembryonic Antigen-related Cell Adhesion Molecule 4
Alternate Names
CEACAM4, CGM7
Gene Symbol
CEACAM4
Additional CEACAM-4 Products
Product Documents for CEACAM4 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CEACAM4 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CEACAM4 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CEACAM4 Antibody - BSA Free and earn rewards!
Have you used CEACAM4 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...