CENPC Antibody [Biotin]

Novus Biologicals | Catalog # NBP3-75107

Fc Region Site-Specific Biotinylated Antibody
Novus Biologicals

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG
View all CENPC Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MSGKNDVDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISGVLSPDTISSKRK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. As a result, each order represents a unique lot.

Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Free biotin from the conjugation process has been removed. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for CENPC Antibody [Biotin]

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended applications and dilutions are based on validated applications from the unconjugated base product

NBP2-55474

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: CENPC

Centromere protein C 1 is a centromere autoantigen and a component of the inner kinetochore plate. The protein is required for maintaining proper kinetochore size and a timely transition to anaphase. A putative pseudogene exists on chromosome 12. [provided by RefSeq]

Alternate Names

CENP-C, CENP-C 1, CENPCInterphase centromere complex protein 7, Centromere autoantigen C, centromere autoantigen C1, centromere protein C 1, hcp-4, ICEN7, MIF2

Gene Symbol

CENPC

Additional CENPC Products

Product Documents for CENPC Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CENPC Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CENPC Antibody [Biotin]

There are currently no reviews for this product. Be the first to review CENPC Antibody [Biotin] and earn rewards!

Have you used CENPC Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies