CGB2 Antibody (4F8) - Azide and BSA Free

Novus Biologicals | Catalog # H00114336-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 4F8

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CGB2 (NP_203696, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSTSPVLAEDIPLRERHVKGAAAVAAAEHGRDMGIQGAASATVPPHQCHPGCGEGG

Specificity

CGB2 - chorionic gonadotropin, beta polypeptide 2

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Scientific Data Images for CGB2 Antibody (4F8) - Azide and BSA Free

Western Blot: CGB2 Antibody (4F8) [H00114336-M02]

Western Blot: CGB2 Antibody (4F8) [H00114336-M02]

Western Blot: CGB2 Antibody (4F8) [H00114336-M02] - detection against Immunogen (31.9 KDa).

Applications for CGB2 Antibody (4F8) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: CGB2

The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone beta (LHB) subunit gene. The CGB genes are primarily distinguished by differences in the 5' untranscribed region. This gene was originally thought to be one of the two pseudogenes (CGB1 and CGB2) of CGB subunit, however, detection of CGB1 and CGB2 transcripts in vivo, and their presence on the polysomes, suggested that these transcripts are translated. To date, a protein product corresponding to CGB2 has not been isolated. The deduced sequence of the hypothetical protein of 132 aa does not share any similarity with that of functional CGB subunits (PMID:8954017). However, a 163 aa protein, translated from a different frame, is about the same size, and shares 98% identity with other CGB subunits.

Alternate Names

choriogonadotropin subunit beta variant 2, chorionic gonadotropin, beta polypeptide 2, product of CGB2

Entrez Gene IDs

114336 (Human)

Gene Symbol

CGB2

OMIM

608824 (Human)

Additional CGB2 Products

Product Documents for CGB2 Antibody (4F8) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CGB2 Antibody (4F8) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CGB2 Antibody (4F8) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review CGB2 Antibody (4F8) - Azide and BSA Free and earn rewards!

Have you used CGB2 Antibody (4F8) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...