CHORDC1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85629

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CHORDC1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CHORDC1 Antibody [NBP1-85629]

Immunocytochemistry/ Immunofluorescence: CHORDC1 Antibody [NBP1-85629]

Immunocytochemistry/Immunofluorescence: CHORDC1 Antibody [NBP1-85629] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
CHORDC1 Antibody - BSA Free Western Blot: CHORDC1 Antibody - BSA Free [NBP1-85629]

Western Blot: CHORDC1 Antibody - BSA Free [NBP1-85629]

Analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-CHORDC1 antibody. Corresponding CHORDC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
CHORDC1 Antibody - BSA Free Western Blot: CHORDC1 Antibody - BSA Free [NBP1-85629]

Western Blot: CHORDC1 Antibody - BSA Free [NBP1-85629]

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
CHORDC1 Antibody - BSA Free Western Blot: CHORDC1 Antibody - BSA Free [NBP1-85629]

Western Blot: CHORDC1 Antibody - BSA Free [NBP1-85629]

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
CHORDC1 Antibody - BSA Free Immunohistochemistry-Paraffin: CHORDC1 Antibody [NBP1-85629]

Immunohistochemistry-Paraffin: CHORDC1 Antibody [NBP1-85629]

Staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.

Applications for CHORDC1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHORDC1

CHORDC1 may be play a role in the regulation of NOD1 via its interaction with HSP90AA1

Alternate Names

CHORD domain-containing protein 1, CHORD-containing protein 1, CHP1CHP-1, cysteine and histidine-rich domain (CHORD) containing 1, cysteine and histidine-rich domain (CHORD)-containing 1, cysteine and histidine-rich domain (CHORD)-containing, zinc-binding protein 1, cysteine and histidine-rich domain-containing protein 1, FLJ37289, Protein morgana

Gene Symbol

CHORDC1

Additional CHORDC1 Products

Product Documents for CHORDC1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CHORDC1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHORDC1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHORDC1 Antibody - BSA Free and earn rewards!

Have you used CHORDC1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...