CLCNKB Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10791

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all CLCNKB Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLCKB. Peptide sequence VESTESQILVGIVRRAQLVQALKAEPPSWAPGHQQCLQDILAAGCPTEPV

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CLCNKB Antibody - BSA Free

Western Blot: CLCNKB Antibody [NBP3-10791]

Western Blot: CLCNKB Antibody [NBP3-10791]

Western Blot: CLCNKB Antibody [NBP3-10791] - Western blot analysis of CLCNKB in Stomach Tumor lysates. Antibody dilution at 1.0ug/ml

Applications for CLCNKB Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CLCNKB

Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney.

Alternate Names

chloride channel KbClC-Kb, chloride channel protein ClC-Kb, chloride channel, kidney, B, ClC-K2, CLCKB, hClC-Kb, MGC24087

Gene Symbol

CLCNKB

Additional CLCNKB Products

Product Documents for CLCNKB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CLCNKB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CLCNKB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CLCNKB Antibody - BSA Free and earn rewards!

Have you used CLCNKB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies