Complement Factor H-related 1/CFHR1/CFHL1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14474

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TGESAEFVCKRGYRLSSRSHTLRTTCWDGKLEYPTCA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Complement Factor H-related 1/CFHR1/CFHL1 Antibody - BSA Free

Western Blot: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Western Blot: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Western Blot: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Immunocytochemistry/ Immunofluorescence: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Immunocytochemistry/Immunofluorescence: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Staining of human testis shows moderate extracellular space positivity in Leydig cells.
Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.
Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Staining of human cervix shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474]

Immunohistochemistry-Paraffin: Complement Factor H-related 1/CFHR1/CFHL1 Antibody [NBP2-14474] - Staining of human kidney shows moderate extracellular space positivity in cells in tubules and glomeruli.

Applications for Complement Factor H-related 1/CFHR1/CFHL1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Complement Factor H-related 1/CFHR1

The CFHL1 gene encodes a secreted protein belonging to the complement factor H protein family. It binds to Pseudomonasaeruginosa elongation factor Tuf together with plasminogen, which is proteolytically activated. It is proposed thatTuf acts as a virulence fac

Alternate Names

BTA, CFHR1, Complement Factor Hrelated 1, FHR1

Gene Symbol

CFHR1

Additional Complement Factor H-related 1/CFHR1 Products

Product Documents for Complement Factor H-related 1/CFHR1/CFHL1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Complement Factor H-related 1/CFHR1/CFHL1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Complement Factor H-related 1/CFHR1/CFHL1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Complement Factor H-related 1/CFHR1/CFHL1 Antibody - BSA Free and earn rewards!

Have you used Complement Factor H-related 1/CFHR1/CFHL1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...