Corticotropin Releasing Factor Antibody (2B11) - Azide and BSA Free

Novus Biologicals | Catalog # H00001392-M02

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA

Label

Unconjugated

Antibody Source

Monoclonal Mouse IgG2a Kappa Clone # 2B11

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

CRH (AAH11031, 154 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK

Specificity

CRH (2B11)

Clonality

Monoclonal

Host

Mouse

Isotype

IgG2a Kappa

Description

Quality control test: Antibody Reactive Against Recombinant Protein.

Scientific Data Images for Corticotropin Releasing Factor Antibody (2B11) - Azide and BSA Free

Western Blot: Corticotropin Releasing Factor Antibody (2B11) [H00001392-M02]

Western Blot: Corticotropin Releasing Factor Antibody (2B11) [H00001392-M02]

Western Blot: Corticotropin Releasing Factor Antibody (2B11) [H00001392-M02] - Analysis of CRH expression in transfected 293T cell line by CRH monoclonal antibody (M02), clone 2B11.Lane 1: CRH transfected lysate(21.4 KDa).Lane 2: Non-transfected lysate.
Sandwich ELISA: Corticotropin Releasing Factor Antibody (2B11) [H00001392-M02] - Detection limit for recombinant GST tagged CRH is 0.3 ng/ml as a capture antibody.

Applications for Corticotropin Releasing Factor Antibody (2B11) - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Formulation, Preparation, and Storage

Purification

IgG purified

Formulation

In 1x PBS, pH 7.4

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: Corticotropin Releasing Factor

Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin dificiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition.

Alternate Names

corticoliberin, corticotropin releasing hormone, Corticotropin-releasing hormone, CRFCorticotropin-releasing factor

Entrez Gene IDs

1392 (Human)

Gene Symbol

CRH

OMIM

122560 (Human)

Additional Corticotropin Releasing Factor Products

Product Documents for Corticotropin Releasing Factor Antibody (2B11) - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Corticotropin Releasing Factor Antibody (2B11) - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Corticotropin Releasing Factor Antibody (2B11) - Azide and BSA Free

Customer Reviews for Corticotropin Releasing Factor Antibody (2B11) - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Corticotropin Releasing Factor Antibody (2B11) - Azide and BSA Free and earn rewards!

Have you used Corticotropin Releasing Factor Antibody (2B11) - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...