CPI17 alpha Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58619

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CPI17 alpha Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GLLKSCGKPVEDFIQELLAKLQGLHRQPGLRQPSPSHDGSLS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CPI17 alpha Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CPI17 alpha Antibody [NBP2-58619]

Immunocytochemistry/ Immunofluorescence: CPI17 alpha Antibody [NBP2-58619]

Immunocytochemistry/Immunofluorescence: CPI17 alpha Antibody [NBP2-58619] - Staining of human cell line CACO-2 shows localization to nucleoplasm.

Applications for CPI17 alpha Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CPI17 alpha

PKC Potentiated Inhibitor Protein-17 (CPI-17) is a 17 kDa protein (1). Expressed in smooth muscles and neuronal cells, CPI-17 is a myosin phosphatase inhibitor protein. Phosphorylation of CPI-17 at Thr38 enhances its inhibitory effect by 100 fold (2). Once phosphorylated, CPI-17 inhibits PP1c and MLCP holoenzyme activity (3).

Alternate Names

17 kDa PKC-potentiated inhibitory protein of PP1, CPI-1717-kDa PKC-potentiated inhibitory protein of PP1, CPI1717-KDa protein, PKC-potentiated inhibitory protein of PP1, PPP1INL, Protein kinase C-potentiated inhibitor protein of 17 kDa, protein phosphatase 1 regulatory subunit 14A, protein phosphatase 1, regulatory (inhibitor) subunit 14A

Gene Symbol

PPP1R14A

Additional CPI17 alpha Products

Product Documents for CPI17 alpha Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CPI17 alpha Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CPI17 alpha Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CPI17 alpha Antibody - BSA Free and earn rewards!

Have you used CPI17 alpha Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies