CTP synthase Antibody (9T4J2)

Novus Biologicals | Catalog # NBP3-33229

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 9T4J2
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CTP synthase (P17812).

Sequence:
SVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for CTP synthase Antibody (9T4J2)

CTP synthase Antibody (9T4J2)

Western Blot: CTP synthase Antibody (9T4J2) [NBP3-33229] -

Western Blot: CTP synthase Antibody (9T4J2) [NBP3-33229] - Western blot analysis of various lysates using CTP synthase Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
CTP synthase Antibody (9T4J2)

Western Blot: CTP synthase Antibody (9T4J2) [NBP3-33229] -

Western Blot: CTP synthase Antibody (9T4J2) [NBP3-33229] - Western blot analysis of various lysates using CTP synthase Rabbit mAb at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 90s.
CTP synthase Antibody (9T4J2)

Immunoprecipitation: CTP synthase Antibody (9T4J2) [NBP3-33229] -

Immunoprecipitation: CTP synthase Antibody (9T4J2) [NBP3-33229] - Immunoprecipitation of CTP synthase from 300 ug extracts of HeLa cells was performed using 0.5 ug of CTP synthase Rabbit mAb. Rabbit Control IgG was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using CTP synthase Rabbit mAb at a dilution of 1:500.

Applications for CTP synthase Antibody (9T4J2)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CTP Synthase/CTPS1

The catalytic conversion of UTP to CTP is accomplished by the enzyme cytidine-5-prime-triphosphate synthetase. The enzyme is important in the biosynthesis of phospholipids and nucleic acids, and plays a key role in cell growth, development, and tumorigenesis. The region to which the CTPS gene has been mapped is the location of breakpoints involved in several tumor types

Long Name

Cytidine 5'-Triphosphate Synthetase

Alternate Names

CTP Synthase 1, GATD5, IMD24

Gene Symbol

CTPS1

Additional CTP Synthase/CTPS1 Products

Product Documents for CTP synthase Antibody (9T4J2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CTP synthase Antibody (9T4J2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CTP synthase Antibody (9T4J2)

There are currently no reviews for this product. Be the first to review CTP synthase Antibody (9T4J2) and earn rewards!

Have you used CTP synthase Antibody (9T4J2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...