CTR2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85512

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Cited:

Immunohistochemistry

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CTR2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: CTR2 Antibody [NBP1-85512]

Immunocytochemistry/ Immunofluorescence: CTR2 Antibody [NBP1-85512]

Immunocytochemistry/Immunofluorescence: CTR2 Antibody [NBP1-85512] - Staining human cell line U-251 MG shows positivity in cytoplasm, intermediate filaments and nucleus but excluded from the nucleoli. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CTR2 Antibody [NBP1-85512]

Immunohistochemistry-Paraffin: CTR2 Antibody [NBP1-85512]

Immunohistochemistry-Paraffin: CTR2 Antibody [NBP1-85512] - Staining of human salivary gland shows cytoplasmic positivity in glandular cells.
CTR2 Antibody - BSA Free

CTR2 Antibody [NBP1-85512] -

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
CTR2 Antibody - BSA Free

CTR2 Antibody [NBP1-85512] -

Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
CTR2 Antibody - BSA Free

CTR2 Antibody [NBP1-85512] -

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Applications for CTR2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CTR2

SLC31A2, also known as CTR2, is a SLC31A transporter family member. Although the function of CTR2 is still poorly understood in mammalian cells, it is expected to be involved in low-affinity copper uptake. It is believed to be confined to lysosomes which stimulate copper delivery to the the cytosol of human cells at high concentrations.

Alternate Names

Copper transporter 2, COPT2SLC13A2, CTR2Solute carrier family 31 member 2, hCTR2probable low affinity copper uptake protein 2, solute carrier family 31 (copper transporters), member 2

Gene Symbol

SLC31A2

Additional CTR2 Products

Product Documents for CTR2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CTR2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CTR2 Antibody - BSA Free

Customer Reviews for CTR2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CTR2 Antibody - BSA Free and earn rewards!

Have you used CTR2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CTR2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All
  • Q: I have searched your website to find ctr2 antibody for my rat experiment(mainly about IHC &WB), however, I found most ctr2 antibody used for mouse and human not for rat.Could you help me to check the information on ctr2 antibody ?Thanks a lot!

    A:

    We have two antibodies to CTR2 - NBP1-05199 which is validated for Western blotting using samples from human and mouse, and NBP1-85512 which is validated for IHC-P using human samples. Human and mouse CTR2 share a 77% sequence homology, however I am unable to align either of these sequence with that of the rat protein, since the rat sequence is not available on UniProt. If you have the rat sequence I would be happy to perform the alignment for you, email technical@novusbio.com. If you wish to try either of these antibodies in an untested species or application I can strongly recommend our Innovators Reward Program. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. This allows us to gain more information on our products, and enables you to save money.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies
Loading...