CXCR2/IL-8RB Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38195

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CXCR2/IL-8RB Antibody - BSA Free

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Analysis in human spleen and cerebral cortex tissues. Corresponding CXCR2/IL-8RB RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Staining of human cerebral cortex, colon, lymph node and spleen using Anti-CXCR2 antibody NBP2-38195 (A) shows similar protein distribution across tissues to independent antibody NBP2-38197 (B).
Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Staining of human spleen shows strong cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195]

Immunohistochemistry-Paraffin: CXCR2/IL-8RB Antibody [NBP2-38195] - Staining of human lymph node shows strong cytoplasmic positivity in non-germinal center cells.

Applications for CXCR2/IL-8RB Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CXCR2/IL-8RB

Chemokine (Chemoattractant Cytokines) are small peptides that are potent activators and chemo-attractants for leukocyte subpopulations and other non-hemopoietic cells. Chemokine receptors (CXCR) belong to the super-family of G protein-coupled receptors (GPCR), which regulate the trafficking and activation of leukocytes, and operate as co-receptors in the entry of HIV-1 and proliferation and migration of immature neurons, glia and their precursors. Furthermore, chemokine receptors participate in the etiology and progression of various brain disorders, including AIDS dementia, neuro-inflammatory disease and neuroplasia, making them important potential therapeutic targets in these cases several subtypes of CXCR have been characterized. Activation of na

Long Name

Interleukin 8 Receptor B

Alternate Names

CD182, CDw128b, CMKAR2, CXCR-2, IL-8 RB, IL8RB

Gene Symbol

CXCR2

UniProt

Additional CXCR2/IL-8RB Products

Product Documents for CXCR2/IL-8RB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CXCR2/IL-8RB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CXCR2/IL-8RB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CXCR2/IL-8RB Antibody - BSA Free and earn rewards!

Have you used CXCR2/IL-8RB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies