Cyclin L2 Antibody - BSA Free
Novus Biologicals | Catalog # NBP2-47497
Loading...
Key Product Details
Species Reactivity
Validated:
Human
Predicted:
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: DRLYSGVLITLENCLLPDDKLRFTPSMSSGLDTDTETDLRVVGCEL
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for Cyclin L2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: Cyclin L2 Antibody [NBP2-47497]
Immunocytochemistry/Immunofluorescence: Cyclin L2 Antibody [NBP2-47497] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.Immunohistochemistry-Paraffin: Cyclin L2 Antibody [NBP2-47497]
Immunohistochemistry-Paraffin: Cyclin L2 Antibody [NBP2-47497] - Staining of human colon tissue. Shows strong nuclear positivity in glandular cells.Western Blot: Cyclin L2 Antibody - BSA Free [NBP2-47497] -
Phosphorylated SAMHD1 loses the ability to inhibit EV71 replicationAStable sh‐SAMHD1 HEK293T cells were transfected with VR1012, SAMHD1 WT, or the indicated mutant for 24 h and then infected with EV71 at a MOI of 0.05 for 72 h. Cells were harvested and subjected to IB analysis.BIB analysis of T592‐phosphorylated SAMHD1 and total SAMHD1 in RD and HEK293T cells.CThe effect of TRIM21 on endogenous phosphorylated SAMHD1 and total SAMHD1.DThe effect of TRIM21 on ectopic phosphorylated and unphosphorylated SAMHD1.E, FTRIM21 directly induced the degradation of SAMHD1 but not via changing cell cycle or upregulating cyclin L2 expression. (E) TRIM21 has no effect on the G0–G1 transition in MDM. (F) TRIM21 has no effect on the expression of cyclin L2 in MDM.Data information: (A–F) Tubulin served as a loading control.Source data are available online for this figure. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31797533), licensed under a CC-BY license. Not internally tested by Novus Biologicals.Applications for Cyclin L2 Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25-2 ug/ml
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: Cyclin L2
Alternate Names
ania-6b, CCNM, cyclin L2, cyclin M, cyclin-L2, DKFZp761A1210, DKFZp762O195, HCLA-ISO, HLA-ISO, Paneth cell-enhanced expression protein, PCEE, SB138
Gene Symbol
CCNL2
Additional Cyclin L2 Products
Product Documents for Cyclin L2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Cyclin L2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Citations for Cyclin L2 Antibody - BSA Free
Customer Reviews for Cyclin L2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Cyclin L2 Antibody - BSA Free and earn rewards!
Have you used Cyclin L2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...