Cytochrome P450 1A1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-37955

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 200-460 of human Cytochrome P450 1A1 (NP_000490.1).

Sequence:
NPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFG

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Cytochrome P450 1A1 Antibody - BSA Free

Cytochrome P450 1A1 Antibody

Immunocytochemistry/ Immunofluorescence: Cytochrome P450 1A1 Antibody [NBP3-37955] -

Immunocytochemistry/ Immunofluorescence: Cytochrome P450 1A1 Antibody [NBP3-37955] - Immunofluorescence analysis of NIH/3T3 cells using Cytochrome P450 1A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Cytochrome P450 1A1 Antibody

Western Blot: Cytochrome P450 1A1 Antibody [NBP3-37955] -

Western Blot: Cytochrome P450 1A1 Antibody [NBP3-37955] - Western blot analysis of various lysates using Cytochrome P450 1A1 Rabbit pAb at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 3s.
Cytochrome P450 1A1 Antibody

Immunocytochemistry/ Immunofluorescence: Cytochrome P450 1A1 Antibody [NBP3-37955] -

Immunocytochemistry/ Immunofluorescence: Cytochrome P450 1A1 Antibody [NBP3-37955] - Immunofluorescence analysis of PC-12 cells using Cytochrome P450 1A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Cytochrome P450 1A1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Cytochrome P450 1A1

The Cytochrome P450 (P450) superfamily of enzymes is one of three enzyme systems which metabolize the fatty acid arachadonic acid (AA) to regulators of vascular tone. P450 enzymes are monooxygenase enzymes which require several co-factors such as nicotinamide adenine dinucleotide phosphate (NADPH) and P450 reductase. There are over 200 known genes which encode P450s. Epoxygenases are those P450s which metabolize AA to epoxyeicosatrienoic acid (EETs) and omega-hydroxylases are those P450s which produce 19- and 20-hydroxyeicosatetraenoic acids (19- and 20-HETE). As well as fatty acid metabolism, P450s also metabolize many drugs and toxins. Cytochrome P450 3A4 is abundantly expressed in liver and small intestine and is inducible by barbiturates, glucocorticoids and rifampicin.

Long Name

Cytochrome P450 1A1

Alternate Names

CYP1A1, CYPIA1, Cytochrome P450-C, Cytochrome P450-P1

Gene Symbol

CYP1A1

Additional Cytochrome P450 1A1 Products

Product Documents for Cytochrome P450 1A1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytochrome P450 1A1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytochrome P450 1A1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytochrome P450 1A1 Antibody - BSA Free and earn rewards!

Have you used Cytochrome P450 1A1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...