Cytokeratin 13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38166

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MSLRLQSSSASYGGGFGGGSCQLGGGRGVSTCSTRFVSGGSAGGYGGGVSCG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (81%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Cytokeratin 13 Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining in human cervix, uterine and skeletal muscle tissues.. Corresponding KRT13 RNA-seq data are presented for the same tissues.
Western Blot: Cytokeratin 13 Antibody [NBP2-38166]

Western Blot: Cytokeratin 13 Antibody [NBP2-38166]

Western Blot: Cytokeratin 13 Antibody [NBP2-38166] - Analysis in human cell lines A-431 and HEK293 using anti-KRT13 antibody. Corresponding KRT13 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/ Immunofluorescence: Cytokeratin 13 Antibody [NBP2-38166]

Immunocytochemistry/ Immunofluorescence: Cytokeratin 13 Antibody [NBP2-38166]

Immunocytochemistry/Immunofluorescence: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human cell line A-431 shows localization to intermediate filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human prostate shows positivity in the basal layer.
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skin shows positivity in epidermal cells.
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human cervix shows positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166]

Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for Cytokeratin 13 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Cytokeratin 13

Alternate Names

CK13, CK-13, cytokeratin 13, Cytokeratin-13, K13cytokeratin-13, keratin 13, keratin, type I cytoskeletal 13, keratin-13, MGC161462, MGC3781

Gene Symbol

KRT13

UniProt

Additional Cytokeratin 13 Products

Product Documents for Cytokeratin 13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Cytokeratin 13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Cytokeratin 13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Cytokeratin 13 Antibody - BSA Free and earn rewards!

Have you used Cytokeratin 13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...