DCP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56996

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence, Chromatin Immunoprecipitation-exo-Seq

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL

Reactivity Notes

Mouse 82%, Rat 83%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DCP2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: DCP2 Antibody [NBP2-56996]

Immunocytochemistry/ Immunofluorescence: DCP2 Antibody [NBP2-56996]

Immunocytochemistry/Immunofluorescence: DCP2 Antibody [NBP2-56996] - Staining of human cell line MCF7 shows localization to nucleoplasm, cell junctions & cytoplasmic bodies. Antibody staining is shown in green.
DCP2 Antibody - BSA Free Chromatin Immunoprecipitation-exo-Seq: DCP2 Antibody - BSA Free [NBP2-56996]

Chromatin Immunoprecipitation-exo-Seq: DCP2 Antibody - BSA Free [NBP2-56996]

ChIP-Exo-Seq composite graph for Anti-DCP2 (NBP2-56996) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

Applications for DCP2 Antibody - BSA Free

Application
Recommended Usage

Chromatin Immunoprecipitation-exo-Seq

1-10ug per reaction

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DCP2

DCP2 is a key component of an mRNA-decapping complex required for removal of the 5-prime cap from mRNA prior to its degradation from the 5-prime end (Fenger-Gron et al., 2005 [PubMed 16364915]).[supplied by OMIM]

Alternate Names

DCP2 decapping enzyme homolog (S. cerevisiae), EC 3.-, FLJ33245, hDpc, mRNA-decapping enzyme 2, nudix (nucleoside diphosphate linked moiety X)-type motif 20, Nudix motif 20, NUDT20Nucleoside diphosphate-linked moiety X motif 20

Gene Symbol

DCP2

Additional DCP2 Products

Product Documents for DCP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DCP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DCP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DCP2 Antibody - BSA Free and earn rewards!

Have you used DCP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...