DDX17 Antibody (2U1P0)

Novus Biologicals | Catalog # NBP3-16607

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 2U1P0 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-200 of human DDX17 (Q92841). RGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DDX17 Antibody (2U1P0)

Western Blot: DDX17 Antibody (2U1P0) [NBP3-16607]

Western Blot: DDX17 Antibody (2U1P0) [NBP3-16607]

Western Blot: DDX17 Antibody (2U1P0) [NBP3-16607] - Western blot analysis of extracts of various cell lines, using DDX17 Rabbit mAb (NBP3-16607) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Western Blot: DDX17 Antibody (2U1P0) [NBP3-16607]

Western Blot: DDX17 Antibody (2U1P0) [NBP3-16607]

Western Blot: DDX17 Antibody (2U1P0) [NBP3-16607] - Western blot analysis of extracts of various cell lines, using DDX17 Rabbit mAb (NBP3-16607) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
DDX17 Antibody (2U1P0)

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] -

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded rat spleen tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
DDX17 Antibody (2U1P0)

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] -

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse intestin tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
DDX17 Antibody (2U1P0)

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] -

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse testis tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
DDX17 Antibody (2U1P0)

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] -

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded rat kidney tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
DDX17 Antibody (2U1P0)

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] -

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded human cervix cancer tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
DDX17 Antibody (2U1P0)

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] -

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse brain tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
DDX17 Antibody (2U1P0)

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] -

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded mouse lung tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
DDX17 Antibody (2U1P0)

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] -

Immunohistochemistry: DDX17 Antibody (2U1P0) [NBP3-16607] - Immunohistochemistry analysis of DDX17 in paraffin-embedded rat brain tissue using DDX17 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.

Applications for DDX17 Antibody (2U1P0)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50-1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: DDX17

DDX17 (p72) is a highly related member of the DEAD box family and is an established RNA helicase. It has been implicated in growth regulation and has been shown to be involved in both pre-mRNA and pre-rRNA processing. This protein has also been reported to act as a transcriptional co-activator for estrogen-receptor alpha (ER ) and shown to interact with co-activators p300/CBP and the RNA polymerase II holoenzyme.

Long Name

DEAD Box Protein 17

Alternate Names

p72, RH70

Gene Symbol

DDX17

Additional DDX17 Products

Product Documents for DDX17 Antibody (2U1P0)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DDX17 Antibody (2U1P0)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DDX17 Antibody (2U1P0)

There are currently no reviews for this product. Be the first to review DDX17 Antibody (2U1P0) and earn rewards!

Have you used DDX17 Antibody (2U1P0)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...