DDX3 Antibody (2D7) - Azide and BSA Free
Novus Biologicals | Catalog # H00008653-M01
Loading...
Key Product Details
Species Reactivity
Human, Mouse
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Sandwich ELISA
Label
Unconjugated
Antibody Source
Monoclonal Mouse IgG1 kappa Clone # 2D7
Format
Azide and BSA Free
Loading...
Product Specifications
Immunogen
DDX3Y (NP_004651, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGWSCSKDKDAYSSFGSRDSRGK
Reactivity Notes
Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.
Specificity
This antibody was raised to human DDX3Y fragment, however it is known to crossreact with DDX3X.
Clonality
Monoclonal
Host
Mouse
Isotype
IgG1 kappa
Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Scientific Data Images for DDX3 Antibody (2D7) - Azide and BSA Free
Western Blot: DDX3 Antibody (2D7) [H00008653-M01]
Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in NIH/3T3.Immunohistochemistry-Paraffin: DDX3 Antibody (2D7) [H00008653-M01]
Immunohistochemistry-Paraffin: DDX3 Antibody (2D7) [H00008653-M01] - Analysis of monoclonal antibody to DDX3Y on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.Western Blot: DDX3 Antibody (2D7) [H00008653-M01]
Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in Raw 264.7.Western Blot: DDX3 Antibody (2D7) [H00008653-M01]
Western Blot: DDX3 Antibody (2D7) [H00008653-M01] - DDX3Y monoclonal antibody (M01), clone 2D7. Analysis of DDX3Y expression in mouse testis.
Sandwich ELISA: DDX3 Antibody (2D7) [H00008653-M01] - Detection limit for recombinant GST tagged DDX3Y is approximately 0.1ng/ml as a capture antibody.
Applications for DDX3 Antibody (2D7) - Azide and BSA Free
Application
Recommended Usage
ELISA
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry
Optimal dilutions of this antibody should be experimentally determined.
Immunohistochemistry-Paraffin
Optimal dilutions of this antibody should be experimentally determined.
Sandwich ELISA
Optimal dilutions of this antibody should be experimentally determined.
Western Blot
Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Formulation, Preparation, and Storage
Purification
IgG purified
Formulation
In 1x PBS, pH 7.4
Format
Azide and BSA Free
Preservative
No Preservative
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Background: DDX3
Alternate Names
DBXCAP-Rf, DDX14, DDX3DEAD/H box-3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked, DEAD box protein 3, X-chromosomal, DEAD box, X isoform, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, EC 3.6.1, EC 3.6.4.13, helicase like protein 2, Helicase-like protein 2, HLP2ATP-dependent RNA helicase DDX3X
Entrez Gene IDs
8653 (Human)
Gene Symbol
DDX3X
OMIM
400010 (Human)
UniProt
Additional DDX3 Products
Product Documents for DDX3 Antibody (2D7) - Azide and BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for DDX3 Antibody (2D7) - Azide and BSA Free
This product is produced by and distributed for Abnova, a company based in Taiwan.
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for DDX3 Antibody (2D7) - Azide and BSA Free
There are currently no reviews for this product. Be the first to review DDX3 Antibody (2D7) - Azide and BSA Free and earn rewards!
Have you used DDX3 Antibody (2D7) - Azide and BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...