Recombinant Human DEAF1 GST (N-Term) Protein

Novus Biologicals | Catalog # H00010522-Q02

Novus Biologicals
Loading...

Key Product Details

Source

Wheat germ

Tag

GST (N-Term)

Applications

Western Blot, ELISA, Affinity Purification, Endotoxin Detection, SDS-PAGE
Loading...

Product Specifications

Description

A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 133-222 of Human DEAF1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTPLAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKNRLGSG

Purity

>80% by SDS-PAGE and Coomassie blue staining

Predicted Molecular Mass

35.53 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Activity

This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.

Protein / Peptide Type

Recombinant Protein

Scientific Data Images for Recombinant Human DEAF1 GST (N-Term) Protein

SDS-PAGE: Recombinant Human DEAF1 GST (N-Term) Protein [H00010522-Q02]

SDS-PAGE: Recombinant Human DEAF1 GST (N-Term) Protein [H00010522-Q02]

SDS-Page: Recombinant Human DEAF1 Protein [H00010522-Q02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Formulation, Preparation, and Storage

H00010522-Q02
Preparation Method in vitro wheat germ expression system
Formulation 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with dry ice or equivalent. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -80C. Avoid freeze-thaw cycles.

Background: DEAF1

Transcription factor that binds to sequence with multiple copies of TTC[CG]G present in its own promoter and that of the HNRPA2B1 gene. Down-regulates transcription of these genes. Binds to the retinoic acid response element (RARE) AGGGTTCACCGAAAGTTCA. Activates the proenkephalin gene independently of promoter binding, probably through protein-protein interaction. When secreted, behaves as an inhibitor of cell proliferation, by arresting cells in the G0 or G1 phase

Alternate Names

deformed epidermal autoregulatory factor 1 (Drosophila), Nuclear DEAF-1-related transcriptional regulator, NUDRdeformed epidermal autoregulatory factor 1 homolog, SPNsuppressin, Zinc finger MYND domain-containing protein 5, ZMYND5Suppressin

Gene Symbol

DEAF1

Additional DEAF1 Products

Product Documents for Recombinant Human DEAF1 GST (N-Term) Protein

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Recombinant Human DEAF1 GST (N-Term) Protein

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customer Reviews for Recombinant Human DEAF1 GST (N-Term) Protein

There are currently no reviews for this product. Be the first to review Recombinant Human DEAF1 GST (N-Term) Protein and earn rewards!

Have you used Recombinant Human DEAF1 GST (N-Term) Protein?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...