Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6)

Novus Biologicals | Catalog # NBP3-16444

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1Q5F6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 186-285 of human Dimethylarginine Dimethylaminohydrolase 1/DDAH1 (O94760). IAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6)

Western Blot: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6) [NBP3-16444]

Western Blot: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6) [NBP3-16444]

Western Blot: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6) [NBP3-16444] - Analysis of extracts of various cell lines, using Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Rabbit mAb (NBP3-16444) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6) [NBP3-16444]

Western Blot: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6) [NBP3-16444]

Western Blot: Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6) [NBP3-16444] - Analysis of extracts of Rat kidney, using Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Rabbit mAb (NBP3-16444) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

Applications for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6)

Application
Recommended Usage

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Dimethylarginine Dimethylaminohydrolase 1/DDAH1

DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.

Alternate Names

DDAHI, Dimethylargininase-1

Gene Symbol

DDAH1

Additional Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Products

Product Documents for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6)

There are currently no reviews for this product. Be the first to review Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6) and earn rewards!

Have you used Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Antibody (1Q5F6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...