DNAH12 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90586

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNAH12 Antibody - BSA Free

DNAH12 Antibody - BSA Free Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Staining of human cerebral cortex).
DNAH12 Antibody - BSA Free Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Analysis in human fallopian tube and liver tissues using NBP1-90586 antibody. Corresponding DNAH12 RNA-seq data are presented for the same tissues.
DNAH12 Antibody - BSA Free Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Staining of human fallopian tube shows moderate positivity in ciliated cells.
DNAH12 Antibody - BSA Free Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Staining of human liver shows no positivity in hepatocytes as expected.
DNAH12 Antibody - BSA Free Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemistry-Paraffin: DNAH12 Antibody [NBP1-90586]

Immunohistochemistry-Paraffin: DNAH12 Antibody [NBP1-90586]

Immunohistochemistry-Paraffin: DNAH12 Antibody [NBP1-90586] - Staining of human prostate shows low expression as expected.
DNAH12 Antibody - BSA Free Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Immunohistochemistry: DNAH12 Antibody - BSA Free [NBP1-90586]

Staining of human lymph node shows no positivity in non-germinal center cells as expected.

Applications for DNAH12 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAH12

Alternate Names

axonemal beta dynein heavy chain 12, axonemal dynein heavy chain isotype3, axonemal, heavy polypeptide 12, ciliary dynein heavy chain 12, DHC3, DLP12, DNAH12L, DNAH7L, DNAHC12, DNAHC3, DNHD2, dynein heavy chain 12, axonemal, dynein heavy chain domain-containing protein 2, dynein, axonemal, heavy chain 12, dynein, heavy chain-5, FLJ40427, FLJ44290, HDHC3, HL19, HL-19

Gene Symbol

DNAH12

Additional DNAH12 Products

Product Documents for DNAH12 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNAH12 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAH12 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAH12 Antibody - BSA Free and earn rewards!

Have you used DNAH12 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...