DNAJB6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49286

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: VADDDALAEERMRRGQNALPAQPAGLRPPKPPRPASLLRHAPHCLSEEEGEQDRPRAPGPWDPLASAAGLK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for DNAJB6 Antibody - BSA Free

Western Blot: DNAJB6 Antibody [NBP2-49286]

Western Blot: DNAJB6 Antibody [NBP2-49286]

Western Blot: DNAJB6 Antibody [NBP2-49286] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251 MG
Lane 4: Human plasma
Lane 5: Human Liver tissue
Lane 6: Human Tonsil tissue
Immunocytochemistry/ Immunofluorescence: DNAJB6 Antibody [NBP2-49286]

Immunocytochemistry/ Immunofluorescence: DNAJB6 Antibody [NBP2-49286]

Immunocytochemistry/Immunofluorescence: DNAJB6 Antibody [NBP2-49286] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DNAJB6 Antibody [NBP2-49286]

Immunohistochemistry-Paraffin: DNAJB6 Antibody [NBP2-49286]

Immunohistochemistry-Paraffin: DNAJB6 Antibody [NBP2-49286] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts, Leydig cells.

Applications for DNAJB6 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: DNAJB6

DNAJB6 encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described.

Alternate Names

DJ4, DKFZp566D0824, DnaJ, DnaJ (Hsp40) homolog, subfamily B, member 6, dnaJ homolog subfamily B member 6, DnaJ-like 2 protein, FLJ42837, Heat shock protein J2, HHDJ1, HSJ2, HSJ-2, MGC1152, MRJMGC117297, MSJ1, MSJ-1

Gene Symbol

DNAJB6

Additional DNAJB6 Products

Product Documents for DNAJB6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for DNAJB6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for DNAJB6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review DNAJB6 Antibody - BSA Free and earn rewards!

Have you used DNAJB6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...