Dopamine beta-Hydroxylase Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-57836

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation, Independent Antibodies

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LINRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKSSAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQ

Reactivity Notes

Mouse 80%

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Dopamine beta-Hydroxylase Antibody - BSA Free

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Analysis in human adrenal gland and testis tissues. Corresponding Dopamine beta-Hydroxylase RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human adrenal gland, kidney, lower gastrointestinal and testis using Anti-Dopamine beta-Hydroxylase antibody NBP2-57836 (A) shows similar protein distribution across tissues to independent antibody NBP2-55677 (B).
Immunocytochemistry/ Immunofluorescence: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunocytochemistry/ Immunofluorescence: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunocytochemistry/Immunofluorescence: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human colon shows moderate cytoplasmic positivity in peripheral ganglion.
Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836]

Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Staining of human kidney shows very weak positivity in cells in tubules as expected.
Dopamine beta-Hydroxylase Antibody

Western Blot: Dopamine beta-Hydroxylase Antibody [NBP2-57836] -

Western Blot: Dopamine beta-Hydroxylase Antibody [NBP2-57836] - Analysis in human cell line SH-SY5Y.

Applications for Dopamine beta-Hydroxylase Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Dopamine beta-Hydroxylase

Dopamine beta-hydroxylase belongs to the copper type II, ascorbate-dependent monooxygenase family and catalyzes the oxidative hydroxylation of dopamine to noradrenaline. It is almost exclusively located in the adrenal medulla and the synaptic vesicles of postganglionic sympathetic neurons being expressed in noradrenergic and adrenergic neurons. DBH serves as a marker of noradrenergic cells.

Alternate Names

DBH, DBM, Dopamine betaHydroxylase, DOPBHY

Gene Symbol

DBH

Additional Dopamine beta-Hydroxylase Products

Product Documents for Dopamine beta-Hydroxylase Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Dopamine beta-Hydroxylase Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Dopamine beta-Hydroxylase Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Dopamine beta-Hydroxylase Antibody - BSA Free and earn rewards!

Have you used Dopamine beta-Hydroxylase Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...