EAR2/NR2F6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86625

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all EAR2/NR2F6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human EAR2/NR2F6. Peptide sequence: GLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for EAR2/NR2F6 Antibody - BSA Free

Western Blot: EAR2/NR2F6 Antibody [NBP2-86625]

Western Blot: EAR2/NR2F6 Antibody [NBP2-86625]

Western Blot: EAR2/NR2F6 Antibody [NBP2-86625] - WB Suggested Anti-NR2F6 Antibody Titration: 5.0ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysateNR2F6 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Applications for EAR2/NR2F6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: EAR2/NR2F6

EAR2 is a nuclear orphan receptor related to the ERB-A superfamily and the COUP-TF family of transcription factors. EAR2 has been shown to be a transcriptional co-repressor of the lutenizing hormone receptor and the thyroid hormone receptor. It has also been shown to associate with negative transcription regulatory elements, and repress promoter activity. Alternate names for EAR2 include nuclear receptor subfamily 2 group F member 6, orphan nuclear receptor EAR-2, V-erbA-related protein, NR2F6, and ERBAL2.

Long Name

ErbA-related 2

Alternate Names

ERBAL2, NR2F6

Gene Symbol

NR2F6

Additional EAR2/NR2F6 Products

Product Documents for EAR2/NR2F6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for EAR2/NR2F6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for EAR2/NR2F6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review EAR2/NR2F6 Antibody - BSA Free and earn rewards!

Have you used EAR2/NR2F6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies