Elk-1 Antibody (10U8X1)
Novus Biologicals | Catalog # NBP3-15631
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, ELISA, Immunoprecipitation
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 10U8X1 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 329-428 of human Elk-1 (NP_001107595.1). GGPGPERTPGSGSGSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Theoretical MW
45 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Scientific Data Images for Elk-1 Antibody (10U8X1)
Western Blot: Elk-1 Antibody (10U8X1) [NBP3-15631]
Western Blot: Elk-1 Antibody (10U8X1) [NBP3-15631] - Western blot analysis of extracts of various cell lines, using Elk-1 antibody (NBP3-15631) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.Immunoprecipitation: Elk-1 Antibody (10U8X1) [NBP3-15631]
Immunoprecipitation: Elk-1 Antibody (10U8X1) [NBP3-15631] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug Elk-1 antibody (NBP3-15631). Western blot was performed from the immunoprecipitate using Elk-1 antibody (NBP3-15631) at a dilition of 1:1000.Applications for Elk-1 Antibody (10U8X1)
Application
Recommended Usage
ELISA
Recommended starting concentration is 1 μg/mL
Immunoprecipitation
0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Western Blot
1:1000 - 1:2000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: Elk-1
Alternate Names
Elk1
Gene Symbol
ELK1
Additional Elk-1 Products
Product Documents for Elk-1 Antibody (10U8X1)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Elk-1 Antibody (10U8X1)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for Elk-1 Antibody (10U8X1)
There are currently no reviews for this product. Be the first to review Elk-1 Antibody (10U8X1) and earn rewards!
Have you used Elk-1 Antibody (10U8X1)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- ELISA Sample Preparation & Collection Guide
- ELISA Troubleshooting Guide
- How to Run an R&D Systems DuoSet ELISA
- How to Run an R&D Systems Quantikine ELISA
- How to Run an R&D Systems Quantikine™ QuicKit™ ELISA
- Immunoprecipitation Protocol
- Quantikine HS ELISA Kit Assay Principle, Alkaline Phosphatase
- Quantikine HS ELISA Kit Principle, Streptavidin-HRP Polymer
- R&D Systems Quality Control Western Blot Protocol
- Sandwich ELISA (Colorimetric) – Biotin/Streptavidin Detection Protocol
- Sandwich ELISA (Colorimetric) – Direct Detection Protocol
- Troubleshooting Guide: ELISA
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...