ENPP-1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38945

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ENPP-1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GLKPSCAKEVKSCKGRCFERTFGNCRCDAACVELGNCCLDYQETCIEPEHIWTC

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ENPP-1 Antibody - BSA Free

Immunohistochemistry-Paraffin: ENPP-1 Antibody [NBP2-38945]

Immunohistochemistry-Paraffin: ENPP-1 Antibody [NBP2-38945]

Immunohistochemistry-Paraffin: ENPP-1 Antibody [NBP2-38945] - Staining of human placenta shows cytoplasmic positivity in stromal cells.
ENPP-1 Antibody

Western Blot: Rabbit Polyclonal ENPP-1 Antibody [NBP2-38945]

Western Blot: Rabbit Polyclonal ENPP-1 Antibody [NBP2-38945] - Western Blot on human valvular intersticial cell samples. Experiment used precast gel, migration at 190 V and a High weight transfer with the transblot. Then the membrane was blocked with BSA 5% for 1 hour and incubated overnight with ENPP-1 Antibody at 1/1000. The next day, after 3 washing we incubated the membrane with anti-rabbit at 1/1000 for 1h at room temperature. After 2 washing we imaged at 800nm. Image from a verified customer review.

Applications for ENPP-1 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 4 using NBP2-38945 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ENPP-1

ENPP1 has a broad specificity and cleaves a variety of substrates, including phosphodiester bonds of nucleotides and nucleotide sugars and pyrophosphate bonds of nucleotides and nucleotide sugars. It can hydrolyze nucleoside 5' triphosphates such as ATP, GTP, CTP, TTP and UTP to their corresponding monophosphates with release of pyrophosphate. It can also hydrolyze diadenosine polyphosphates and 3',5'-cAMP to AMP. It may play a role in the regulation of pyrophosphate production, the regulation of the availability of nucleotide sugars in the endoplasmic reticulum and Golgi, and the regulation of purinergic signaling.

Long Name

Ectonucleotide Pyrophosphatase/Phosphodiesterase 1

Alternate Names

ENPP1, Ly-41 Antigen, M6S1, NPP1, NPPS, PCA1, PDNP1

Gene Symbol

ENPP1

UniProt

P22413 (Human)

Additional ENPP-1 Products

Product Documents for ENPP-1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ENPP-1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ENPP-1 Antibody - BSA Free

Customer Reviews for ENPP-1 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ENPP-1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Standard curve of ENPP1 antibody in Western Blot
    Name: Anonymous
    Application: Western Blot
    Sample Tested: Human valvular intersticial cells
    Species: Human
    Verified Customer | Posted 12/02/2024
    Chemidoc 800 nm
    We did a western blot on human cells sample to determine the best quantity to use and load in wells. So, we used precast gel, migration at 190 V and a High weight transfer with the transblot. Then we blocked the membrane with BSA 5% for 1 hour and incubated overnight with the antibody at 1/1000. The next day, after 3 washing we incubated the membrane with anti-rabbit at 1/1000 for 1h at room temperature. After 2 washing we imaged at 800nm.
    ENPP-1 Antibody - BSA Free NBP2-38945
    Bio-Techne Response
    This review reflects a new species or application tested on a primary antibody.

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies