ENT2 Antibody (7B2J3)

Novus Biologicals | Catalog # NBP3-33206

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, ELISA, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 7B2J3
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENT2 (Q14542).

Sequence:
MARGDAPRDSYHLVGISFFILGLGTLLPWNFFITAIPYFQARLAGAGNSTARILSTNHTGPEDAFNFNNWVTLLSQLPLLLFTLLNSFLYQCVPETVRIL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

50 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ENT2 Antibody (7B2J3)

ENT2 Antibody (7B2J3)

Immunohistochemistry: ENT2 Antibody (7B2J3) [NBP3-33206] -

Immunohistochemistry: ENT2 Antibody (7B2J3) [NBP3-33206] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using ENT2 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
ENT2 Antibody (7B2J3)

Immunohistochemistry: ENT2 Antibody (7B2J3) [NBP3-33206] -

Immunohistochemistry: ENT2 Antibody (7B2J3) [NBP3-33206] - Immunohistochemistry analysis of paraffin-embedded Human esophageal cancer using ENT2 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
ENT2 Antibody (7B2J3)

Immunocytochemistry/ Immunofluorescence: ENT2 Antibody (7B2J3) [NBP3-33206] -

Immunocytochemistry/ Immunofluorescence: ENT2 Antibody (7B2J3) [NBP3-33206] - Confocal imaging of C2C12 cells using ENT2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Applications for ENT2 Antibody (7B2J3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ENT2

The uptake of nucleosides by transporters, such as SLC29A2, is essential for nucleotide synthesis by salvage pathways in cells that lack de novo biosynthetic pathways. Nucleoside transport also plays a key role in the regulation of many physiologic processes through its effect on adenosine concentration at the cell surface (Griffiths et al., 1997 [PubMed 9396714]).[supplied by OMIM]

Long Name

Equilibrative nucleoside transporter 2

Alternate Names

DER12, HNP36, SLC29A2

Gene Symbol

SLC29A2

Additional ENT2 Products

Product Documents for ENT2 Antibody (7B2J3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ENT2 Antibody (7B2J3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ENT2 Antibody (7B2J3)

There are currently no reviews for this product. Be the first to review ENT2 Antibody (7B2J3) and earn rewards!

Have you used ENT2 Antibody (7B2J3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...