Epsin 1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03439

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 130-180 of human Epsin 1 (NP_037465.2). LVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Epsin 1 Antibody - Azide and BSA Free

Western Blot: Epsin 1 AntibodyAzide and BSA Free [NBP3-03439]

Western Blot: Epsin 1 AntibodyAzide and BSA Free [NBP3-03439]

Western Blot: Epsin 1 Antibody [NBP3-03439] - Analysis of extracts of various cell lines, using Epsin 1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Immunohistochemistry-Paraffin: Epsin 1 Antibody - Azide and BSA Free [NBP3-03439]

Immunohistochemistry-Paraffin: Epsin 1 Antibody - Azide and BSA Free [NBP3-03439]

Immunohistochemistry-Paraffin: Epsin 1 Antibody [NBP3-03439] - Immunohistochemistry of paraffin-embedded Mouse kidney using Epsin 1 Rabbit pAb (NBP3-03439) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Epsin 1 Antibody - Azide and BSA Free [NBP3-03439]

Immunohistochemistry-Paraffin: Epsin 1 Antibody - Azide and BSA Free [NBP3-03439]

Immunohistochemistry-Paraffin: Epsin 1 Antibody [NBP3-03439] - Immunohistochemistry of paraffin-embedded Rat kidney using Epsin 1 Rabbit pAb (NBP3-03439) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Applications for Epsin 1 Antibody - Azide and BSA Free

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Immunohistochemistry

1:50-1:200

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Epsin 1

EPN1 is an endocytic accessory protein that interacts with EPS15 (MIM 600051), the alpha subunit of the clathrin adaptor AP2 (AP2A1; MIM 601026), and clathrin (see MIM 118960), as well as with other accessory proteins for the endocytosis of clathrin-coated vesicles.(supplied by OMIM)

Alternate Names

EH domain-binding mitotic phosphoprotein, EPS-15-interacting protein 1, epsin 1, epsin-1

Gene Symbol

EPN1

Additional Epsin 1 Products

Product Documents for Epsin 1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Epsin 1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Epsin 1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review Epsin 1 Antibody - Azide and BSA Free and earn rewards!

Have you used Epsin 1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...