ER Membrane Protein Complex Subunit 10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30611

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (90%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: DQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKN

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ER Membrane Protein Complex Subunit 10 Antibody - BSA Free

Western Blot: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611]

Western Blot: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611]

Western Blot: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611]

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611]

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611] - Staining of human testis shows weak cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611]

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611]

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611] - Staining of human Fallopian tube shows very weak positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611]

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611]

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611] - Staining of human liver shows very weak membranous positivity in hepatocytes.
Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611]

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611]

Immunohistochemistry-Paraffin: ER Membrane Protein Complex Subunit 10 Antibody [NBP2-30611] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Applications for ER Membrane Protein Complex Subunit 10 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ER Membrane Protein Complex Subunit 10

Alternate Names

C19orf63, Chromosome 19 Open Reading Frame 63, EMC10, Hematopoietic Signal Peptide-Containing Membrane Domain-Containing 1, Hematopoietic Signal Peptide-Containing Membrane Domain-Containing Protein 1, Hematopoietic Signal Peptide-Containing Secreted 1, HSM1, HSS1, INM02, UPF0510 Protein INM02

Gene Symbol

EMC10

UniProt

Additional ER Membrane Protein Complex Subunit 10 Products

Product Documents for ER Membrane Protein Complex Subunit 10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ER Membrane Protein Complex Subunit 10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ER Membrane Protein Complex Subunit 10 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ER Membrane Protein Complex Subunit 10 Antibody - BSA Free and earn rewards!

Have you used ER Membrane Protein Complex Subunit 10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...