EWSR1 Antibody (9G3H1)
Novus Biologicals | Catalog # NBP3-16845
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 9G3H1 expressed in HEK293
Loading...
Product Specifications
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-189 of human EWSR1 (Q01844). MASTDYSTYSQAAAQQGYSAYTAQPTQGYAQTTQAYGQQSYGTYGQPTDVSYTQAQTTATYGQTAYATSYGQPPTGYTTPTAPQAYSQPVQGYGTGAYDTTTATVTTTQASYAAQSAYGTQPAYPAYGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGYGQSNYSYPQVPGSYPMQPVTAPPS
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for EWSR1 Antibody (9G3H1)
Western Blot: EWSR1 Antibody (9G3H1) [NBP3-16845]
Western Blot: EWSR1 Antibody (9G3H1) [NBP3-16845] - Western blot analysis of extracts of various cell lines, using EWSR1 Rabbit mAb (NBP3-16845) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845]
Immunocytochemistry/Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunofluorescence analysis of U-2 OS cells using EWSR1 Rabbit mAb (NBP3-16845) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845]
Immunocytochemistry/Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunofluorescence analysis of C6 cells using EWSR1 Rabbit mAb (NBP3-16845) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunocytochemistry/ Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845]
Immunocytochemistry/Immunofluorescence: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunofluorescence analysis of NIH-3T3 cells using EWSR1 Rabbit mAb (NBP3-16845) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human breast cancer tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded rat colon tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse kidney tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse lung tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse colon tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human thyroid tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded rat spleen tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human tonsil tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded human breast tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse heart tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] -
Immunohistochemistry: EWSR1 Antibody (9G3H1) [NBP3-16845] - Immunohistochemistry analysis of EWSR1 in paraffin-embedded mouse liver tissue using EWSR1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.Applications for EWSR1 Antibody (9G3H1)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Immunohistochemistry
1:50 - 1:200
Immunoprecipitation
1:500 - 1:1000
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: EWSR1
Long Name
RNA-binding protein EWS
Alternate Names
EWS, EWS oncogene
Gene Symbol
EWSR1
Additional EWSR1 Products
Product Documents for EWSR1 Antibody (9G3H1)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for EWSR1 Antibody (9G3H1)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for EWSR1 Antibody (9G3H1)
There are currently no reviews for this product. Be the first to review EWSR1 Antibody (9G3H1) and earn rewards!
Have you used EWSR1 Antibody (9G3H1)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Immunoprecipitation Protocol
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...