Exosome component 7 Antibody (0B8G6)

Novus Biologicals | Catalog # NBP3-15259

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 0B8G6 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 192-291 of human Exosome component 7 (Q15024). LSVENVPCIVTLCKIGYRHVVDATLQEEACSLASLLVSVTSKGVVTCMRKVGKGSLDPESIFEMMETGKRVGKVLHASLQSVVHKEESLGPKRQKVGFLG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Exosome component 7 Antibody (0B8G6)

Western Blot: Exosome component 7 Antibody (0B8G6) [NBP3-15259]

Western Blot: Exosome component 7 Antibody (0B8G6) [NBP3-15259]

Western Blot: Exosome component 7 Antibody (0B8G6) [NBP3-15259] - Western blot analysis of extracts of various cell lines, using Exosome component 7 antibody (NBP3-15259) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry-Paraffin: Exosome component 7 Antibody (0B8G6) [NBP3-15259]

Immunohistochemistry-Paraffin: Exosome component 7 Antibody (0B8G6) [NBP3-15259]

Immunohistochemistry-Paraffin: Exosome component 7 Antibody (0B8G6) [NBP3-15259] - Immunohistochemistry of paraffin-embedded human liver cancer using Exosome component 7 Rabbit mAb (NBP3-15259) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Applications for Exosome component 7 Antibody (0B8G6)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Exosome component 7

Exosome component 7 is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. Required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA. H

Alternate Names

EAP1, exosome complex exonuclease RRP42, exosome component 7Rrp42p, KIAA0116hRrp42p, p8FLJ26543, RRP42Ribosomal RNA-processing protein 42

Gene Symbol

EXOSC7

Additional Exosome component 7 Products

Product Documents for Exosome component 7 Antibody (0B8G6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Exosome component 7 Antibody (0B8G6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Exosome component 7 Antibody (0B8G6)

There are currently no reviews for this product. Be the first to review Exosome component 7 Antibody (0B8G6) and earn rewards!

Have you used Exosome component 7 Antibody (0B8G6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...