FAM60A Antibody - Azide and BSA Free

Novus Biologicals | Catalog # H00058516-B02P

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Immunohistochemistry-Paraffin, Western Blot, IF/IHC, Knockdown Validated

Label

Unconjugated

Antibody Source

Polyclonal Mouse IgG

Format

Azide and BSA Free
Loading...

Product Specifications

Immunogen

FAM60A (NP_067061.1, 1 a.a. - 221 a.a.) full-length human protein. MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

Clonality

Polyclonal

Host

Mouse

Isotype

IgG

Scientific Data Images for FAM60A Antibody - Azide and BSA Free

Western Blot: FAM60A Antibody [H00058516-B02P]

Western Blot: FAM60A Antibody [H00058516-B02P]

Western Blot: FAM60A Antibody [H00058516-B02P] - Analysis of FAM60A expression in transfected 293T cell line by FAM60A polyclonal antibody. Lane 1: FAM60A transfected lysate(24.31 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: FAM60A Antibody [H00058516-B02P]

Immunocytochemistry/ Immunofluorescence: FAM60A Antibody [H00058516-B02P]

Immunocytochemistry/Immunofluorescence: FAM60A Antibody [H00058516-B02P] - Analysis of purified antibody to FAM60A on HeLa cell. (antibody concentration 30 ug/ml)
FAM60A Antibody - Azide and BSA Free

Western Blot: FAM60A Antibody - Azide and BSA Free [H00058516-B02P] -

FAM60A is a repressor of ferroptosis. (A) The viability of cells treated with different concentrations of erastin in FAM60A-knockdown AsPC-1 cells was assessed; n = 3. (B) Effects of ferroptosis inhibitor Ferrostatin-1 (2 μM), apoptosis inhibitor Z-VAD-FMK (5 μM), and necrosis inhibitor Necrostatin-1 (2 μM) on the proliferation capacity of FAM60A knockdown AsPC-1 cells; n = 3. (C) Heatmap of ferroptosis-related genes changes in RNA-Seq data. (D) Transmission electron microscopy to observe the effect of FAM60A knockdown on mitochondrial morphology in PDAC cells. (E) Effect of FAM60A knockdown on ROS content in PDAC cells; n = 3. (F) Effect of FAM60A knockdown on GSH/GSSG content in PDAC cells; n = 3. (G) Western blotting experiment examined the effect of FAM60A knockdown on GPX4 protein expression levels. (H) Western blotting experiment examined the effect of FAM60A knockdown on ACSL4 protein expression levels. ***P < 0.001, **P < 0.01, *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38314086), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
FAM60A Antibody - Azide and BSA Free

Knockdown Validated: FAM60A Antibody - Azide and BSA Free [H00058516-B02P] -

FAM60A knockdown prevents PDAC tumor growth and promotes gemcitabine sensitivity. (A) The efficiency of FAM60A knockdown by transfecting siRNAs was evaluated by qRT-PCR; n = 3. (B) CCK-8 experiments detected the efficiency of using siRNAs knockdown FAM60A on cell proliferation; n = 3. (C) Western blotting experiments verified the efficiency of knockdown FAM60A by shRNA. (D) Plate clonal formation experiments detected the effect of FAM60A stable knockdown on cell survival; n = 3. (E) Cell viability was measured in sh-FAM60A-NC, sh-FAM60A-1, and sh-FAM60A-2 cells treated with the 10 nM gemcitabine (Gem); n = 3. (F) Examples of bioluminescent pictures taken from luciferase-expressing Capan-1 cells that were orthotopically implanted into nude mice treated with 0.9% sodium chloride or gemcitabine (50 mg/kg). (G) Quantification of mice’s flux luminescence is conducted with IVIS. (H) Survival curves of mice implanted with sh-FAM60A-NC or sh-FAM60A-1 cells respectively treated with NaCl or gemcitabine and 0.9% NaCl (n = 5). ***P < 0.001, **P < 0.01, *P < 0.05. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38314086), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for FAM60A Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry

Optimal dilutions of this antibody should be experimentally determined.

Immunohistochemistry-Paraffin

Optimal dilutions of this antibody should be experimentally determined.

Knockdown Validated

Optimal dilutions of this antibody should be experimentally determined.

Western Blot

Optimal dilutions of this antibody should be experimentally determined.
Application Notes
Immunohistochemistry and knockdown validation (PMID: 31727367).

Formulation, Preparation, and Storage

Purification

Protein G purified

Formulation

PBS (pH 7.4)

Format

Azide and BSA Free

Preservative

No Preservative

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.

Background: FAM60A

Alternate Names

C12orf14, chromosome 12 open reading frame 14, family with sequence similarity 60, member A, TERA, Tera protein homolog

Gene Symbol

SINHCAF

Additional FAM60A Products

Product Documents for FAM60A Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FAM60A Antibody - Azide and BSA Free

This product is produced by and distributed for Abnova, a company based in Taiwan.

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for FAM60A Antibody - Azide and BSA Free

Customer Reviews for FAM60A Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review FAM60A Antibody - Azide and BSA Free and earn rewards!

Have you used FAM60A Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...