Fatty Acid Synthase/FASN Antibody (4U9S3)

Novus Biologicals | Catalog # NBP3-15634

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 4U9S3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human FASN (P49327). AVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSS

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

273 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Fatty Acid Synthase/FASN Antibody (4U9S3)

Western Blot: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634]

Western Blot: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634]

Western Blot: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634] - Analysis of extracts of various cell lines, using Fatty Acid Synthase/FASN antibody (NBP3-15634) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
Immunoprecipitation: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634]

Immunoprecipitation: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634]

Immunoprecipitation: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634] - Analysis of 300ug extracts of HeLa cells using 3ug Fatty Acid Synthase/FASN antibody (NBP3-15634). Western blot was performed from the immunoprecipitate using Fatty Acid Synthase/FASN antibody (NBP3-15634) at a dilition of 1:500.
Fatty Acid Synthase/FASN Antibody (4U9S3)

Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] -

Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Fatty Acid Synthase/FASN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunocytochemistry/ Immunofluorescence: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634]

Immunocytochemistry/ Immunofluorescence: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634]

Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody (4U9S3) [NBP3-15634] - Analysis of NIH-3T3 cells using Fatty Acid Synthase/FASN Rabbit mAb (NBP3-15634) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Fatty Acid Synthase/FASN Antibody (4U9S3)

Immunocytochemistry/ Immunofluorescence: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] -

Immunocytochemistry/ Immunofluorescence: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] - Immunofluorescence analysis of HeLa cells using Fatty Acid Synthase/FASN Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Fatty Acid Synthase/FASN Antibody (4U9S3)

Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] -

Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] - Immunohistochemistry analysis of paraffin-embedded Mouse skin tissue using Fatty Acid Synthase/FASN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Fatty Acid Synthase/FASN Antibody (4U9S3)

Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] -

Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] - Immunohistochemistry analysis of paraffin-embedded Rat fat tissue using Fatty Acid Synthase/FASN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Fatty Acid Synthase/FASN Antibody (4U9S3)

Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] -

Immunohistochemistry: Fatty Acid Synthase/FASN Antibody (4U9S3) [Fatty Acid Synthase/FASN] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer tissue using Fatty Acid Synthase/FASN Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for Fatty Acid Synthase/FASN Antibody (4U9S3)

Application
Recommended Usage

ELISA

Recommended starting concentration is 1 μg/mL

Immunocytochemistry/ Immunofluorescence

1:100 - 1:800

Immunohistochemistry

1:500 - 1:2000

Immunohistochemistry-Paraffin

1:500 - 1:2000

Immunoprecipitation

0.5 μg - 4 μg antibody for 200 μg - 400 μg extracts of whole cells

Western Blot

1:3000 - 1:12000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Fatty Acid Synthase/FASN

Fatty Acid Synthase (FAS) is a very large enzymatic system involved in de novo lipogenesis (triglyceride production). Specifically, FAS catalyzes the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. It is also one of the accepted markers for insulin resistance and SREBP, LXR activation.

In some cancer cell lines, FAS has been found to be fused with ER-alpha. Therefore, FAS antibodies are useful tools for studies on fatty acid synthesis and research on certian cancers.

Alternate Names

FASN, OA-519, SDR27X1

Gene Symbol

FASN

Additional Fatty Acid Synthase/FASN Products

Product Documents for Fatty Acid Synthase/FASN Antibody (4U9S3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Fatty Acid Synthase/FASN Antibody (4U9S3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Fatty Acid Synthase/FASN Antibody (4U9S3)

There are currently no reviews for this product. Be the first to review Fatty Acid Synthase/FASN Antibody (4U9S3) and earn rewards!

Have you used Fatty Acid Synthase/FASN Antibody (4U9S3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...