FBXW9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79823

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human FBXW9The immunogen for this antibody is FBXW9. Peptide sequence PDILVTGTYDKKVTIYDPRAGPALLKHQQLHSRPVLTLLADDRHIISGSE. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for FBXW9 Antibody - BSA Free

Western Blot: FBXW9 Antibody [NBP1-79823]

Western Blot: FBXW9 Antibody [NBP1-79823]

Western Blot: FBXW9 Antibody [NBP1-79823] - HepG2 Cell Lysate 1ug/ml Gel Concentration 12%

Applications for FBXW9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: FBXW9

FBXW9, also known as F-box/WD repeat-containing protein 9, has 3 isoforms, a 488 amino acid isoform that is 54 kDa, a 478 amino acid isoform that is 53 kDa and a 458 amino acid isoform that is 51 kDa; acts as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. The protein is being studied for its involvement in neuronitis. FBXW9 has been shown to have interactions with SKP1, COPS6 and UBC in association of TriC/CCT with target proteins during biosynthesis, chaperonin-mediated protein folding, metabolism of proteins, and protein folding pathways.

Alternate Names

F-box and WD repeat domain containing 9, F-box and WD-40 domain protein 9, F-box and WD-40 domain-containing protein 9, F-box and WD-40 repeat containing protein 9, specificity factor for SCF ubiquitin ligase

Gene Symbol

FBXW9

Additional FBXW9 Products

Product Documents for FBXW9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FBXW9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for FBXW9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review FBXW9 Antibody - BSA Free and earn rewards!

Have you used FBXW9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...