FGF-11 Recombinant Protein Antigen

Novus Biologicals | Catalog # NBP2-62694PEP

Novus Biologicals
Loading...

Key Product Details

Applications

Antibody Competition
Loading...

Product Specifications

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FGF-11

Source: E.coli

Amino Acid Sequence: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Purity

>80% by SDS-PAGE and Coomassie blue staining

Applications

Antibody Competition (10-100 molar excess)

Application Notes

This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62694It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Protein / Peptide Type

Recombinant Protein Antigen

Formulation, Preparation, and Storage

NBP2-62694PEP
Formulation PBS and 1M Urea, pH 7.4.
Preservative No Preservative
Concentration Please see the vial label for concentration. If unlisted please contact technical services.
Shipping The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage Store at -20C. Avoid freeze-thaw cycles.

Background: FGF-11

FGF11 encodes a 225 amino acid long, 25 kDA fibroblast growth factor 11 protein that probably acts in nervous system development and function as it is a member of the fibroblast growth factor (FGF) family. Its exact function is unknown but the pattern of expression in mouse homolog implies this nervous system development. FGF11 is associated with breast cancer, melanoma, adenocarcinoma, and pancreatitis. It participates in the regulation of actin cytoskeleton, melanoma, MAPK signaling pathway, paxillian interaction, telomerase components in cell signaling, and mitochondrial apoptosis. FGF11 is known to interact with genes: EGFR, FGFR1, FGFR2, FGFR3, and FGFR4.

Long Name

Fibroblast Growth Factor 11

Alternate Names

FGF11

Gene Symbol

FGF11

Additional FGF-11 Products

Product Documents for FGF-11 Recombinant Protein Antigen

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for FGF-11 Recombinant Protein Antigen

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for FGF-11 Recombinant Protein Antigen

There are currently no reviews for this product. Be the first to review FGF-11 Recombinant Protein Antigen and earn rewards!

Have you used FGF-11 Recombinant Protein Antigen?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Proteins and Enzymes
Loading...