FGF acidic/FGF1, also known as ECGF and HBGF-1, is a secreted mitogen that stimulates the proliferation of all cells of mesodermal origin and many cells of neuroectodermal, ectodermal, and endodermal origin. It plays a number of roles in development, regeneration, and angiogenesis. FGF1 is released extracellularly as a disulfide-linked homodimer and is stored in complex with extracellular heparan sulfate. The association of FGF1 with heparan sulfate is a prerequisite for its subsequent interaction with FGF receptors. Internalized FGF1 can translocate to the cytosol and to the nucleus. Intracellular FGF1 functions as a survival factor by inhibiting p53 activity and proapoptotic signaling.
FGF acidic/FGF1 Antibody (3X3E5)
Novus Biologicals | Catalog # NBP3-16609
Recombinant Monoclonal Antibody
![Western Blot: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609]](https://resources.rndsystems.com/images/products/FGF-acidic-FGF1-Antibody-3X3E5-Western-Blot-NBP3-16609-img0004.jpg "Western Blot: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609]")
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 3X3E5 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 56-155 of human FGF acidic/FGF1 (P05230). HIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for FGF acidic/FGF1 Antibody (3X3E5)
Western Blot: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609]
Western Blot: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609] - Western blot analysis of extracts of various cell lines, using FGF acidic/FGF1 Rabbit mAb (NBP3-16609) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Immunocytochemistry/ Immunofluorescence: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609] -
Immunocytochemistry/ Immunofluorescence: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609] - Confocal imaging of NIH/3T3 cells using FGF acidic/FGF1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Immunocytochemistry/ Immunofluorescence: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609] -
Immunocytochemistry/ Immunofluorescence: FGF acidic/FGF1 Antibody (3X3E5) [NBP3-16609] - Confocal imaging of U-2 OS cells using FGF acidic/FGF1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.Applications for FGF acidic/FGF1 Antibody (3X3E5)
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
1:50 - 1:200
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: FGF acidic/FGF1
Long Name
Fibroblast Growth Factor acidic
Alternate Names
alpha-ECGF, beta-ECGF, FGF acidic, FGF-1, HBGF-1
Gene Symbol
FGF1
Additional FGF acidic/FGF1 Products
Product Documents for FGF acidic/FGF1 Antibody (3X3E5)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for FGF acidic/FGF1 Antibody (3X3E5)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Customer Reviews for FGF acidic/FGF1 Antibody (3X3E5)
There are currently no reviews for this product. Be the first to review FGF acidic/FGF1 Antibody (3X3E5) and earn rewards!
Have you used FGF acidic/FGF1 Antibody (3X3E5)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for FGF acidic/FGF1 Antibody (3X3E5)
Showing
1
-
1 of
1 FAQ
Showing All
-
Q: What is the heparin binding activity of FGF and VEGF?
A: These proteins are not assayed for their ability to bind Heparin. More information about the FGF family of growth factors is available in this review article: Basilico, C. (1992) Adv. Can. Res. 59:115.
Loading...